KEGG   Drosophila grimshawi: Dgri_GH18424Help
Entry
Dgri_GH18424      CDS       T01061                                 

Definition
GH18424 gene product from transcript GH18424-RA
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
dgr  Drosophila grimshawi
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Dgri_GH18424
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Dgri_GH18424
Enzymes [BR:dgr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Dgri_GH18424
Lipid biosynthesis proteins [BR:dgr01004]
 Desaturase
  First
   Dgri_GH18424
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 475 aa AA seqDB search
MGHLSTSERVCSTTPVASTGEGSPPLLSSRRAKLSGEQSQARGRGEDSSPESMPRAKQQQ
KTLAAAATAQQQSVMAPPAPRHIPKYLINHVPKDQINMDEYTRNFQGDNILGWQFKAPLK
WDKVIQISLLHLVALICLLTYPLHELRLNTLIWSFFMGGVAGFGVTAGAHRFWTHRSYKA
NTLLRSLLMISYSVAGQNTLYDWVRDHRVHHKYSETDADPHNANRGFFFSHVGWLMMLKH
PDVLRRGRQIDMSDILADPVIQFHQKYFVLLKIMLCFVLPTMVPVYCWNDTWFHAFVHQC
IFRYVFSLNFTWSVNSAAHLWGSRPYDKRIMPSENIYVSIMAMGEGWHNYHHVFPWDYKA
AELGNYKVNFTTMVLDTFHRLGWAWDMKQPSKELVRRTLEKYGDGTHASQQGVAEATTSS
GVIGSTQMVGHIHYAEVPDPELEYDAESSSTESAKLDENDNESERQKKGTKKLAI
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgggacacctgtccacatcggagcgtgtgtgcagcacaacgcctgtggcaagcacaggt
gagggcagtccaccgcttctctcttctcgtcgcgccaagctgagcggcgagcagtcgcag
gcgcgtggacgtggcgaggactcatcgccggagtcgatgccgcgcgccaagcagcaacag
aagacgctggcagcagcagcaacagcacagcagcaatctgtaatggcaccgccggcgcca
aggcatatacccaaatatctgatcaatcatgtacccaaggatcaaatcaatatggacgaa
tatacgcgtaatttccaaggcgacaatattcttggctggcaattcaaggcaccactaaaa
tgggacaaagtcattcagatctcgctgctgcatctggtcgccttaatctgtctactcacc
tatccgctgcacgagttgcgcctcaacacactcatctggtccttctttatgggtggcgtg
gctggatttggcgtcactgcgggcgcccatcgcttctggacacatcgcagctacaaggcg
aacacgctcctgaggagtctcctcatgatcagttactcggtggctggacagaatacgctg
tacgattgggtgcgggatcatcgggtgcatcacaagtactcggagacggatgccgatccg
cataatgccaatcgcggcttcttcttctcccacgtcggctggctgatgatgctcaagcat
ccagatgtactgcgtcgtggcaggcaaatcgatatgtccgacattctggccgatcctgtc
atccagttccatcaaaagtattttgtgctgctcaagatcatgctgtgcttcgtgctgccc
acaatggtgccggtgtattgctggaacgacacctggttccatgcgtttgtccatcagtgc
atcttccgctatgtgttcagcctgaatttcacctggtccgtcaacagcgctgctcatctc
tggggctcccgtccgtacgacaaacgcatcatgcccagcgagaatatctatgtgtcgatt
atggcgatgggtgagggctggcacaactatcatcatgtcttcccctgggactacaaagca
gctgagctgggcaactataaggtgaactttaccaccatggtgctggatacgttccatcgc
ctgggctgggcctgggacatgaagcagccgtccaaggagctggtgcgtcgcactctcgag
aaatatggcgatggcacacacgcctcccagcagggtgtggctgaggcaaccacatccagt
ggcgttatcggcagcactcaaatggttggacacatccattatgccgaggtgccggatcca
gaactggagtacgatgcggagtcgagcagcactgagagcgccaagctggacgagaatgac
aatgagagcgaacgacagaagaagggcaccaagaagttggccatttag

DBGET integrated database retrieval system