KEGG   Drosophila grimshawi: Dgri_GH18436Help
Entry
Dgri_GH18436      CDS       T01061                                 

Definition
GH18436 gene product from transcript GH18436-RA
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dgr  Drosophila grimshawi
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dgri_GH18436
Enzymes [BR:dgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Dgri_GH18436
Exosome [BR:dgr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dgri_GH18436
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 542 aa AA seqDB search
MILHLFALGTIVVLASGYALPTREAERGMHPVYKADAAELRSKRASMPVMTFPSLKVEQY
AEYWRSIANQTLEQQLESKMRLNTQLAKNIMLFLGDGMSIPTITAGRVYLGGEEKQFAFE
QFPYVGLSKTYCANMQVADSACTATAYLCGVKANYGTVGVTAAVHMKDCFAQSQPEHQVA
SIAEWAQRQGMATGLITTTSVTHASPAGIYAHIANRNWENDADVQADGADPSVCADIASQ
LVYGPVGQNLNVILGGGRENFLPEHVRDTSGQLGRRKDGRNLIEEWRRQHTNSAHYVYTR
RQLLELSNQTSRVLGLFAPYHMPYHLDSNAEELPTLEEMVQAAMDILERQSGGRGYFLFV
EGGRIDHGHHDTLALRAIDETAEFDKSVRWARTHSSVEDTLIVVTSDHSHTMSLAGYSSR
KNDIFGINDGQLAADDLPYATLSYANGPGYNSNYLREGGAVKRKNLRAINMKNKDFMFPT
AVPLESETHGGDDVAVFASGPYAQLFSGVYEQHFIPHAMAYASCLSESRSMCSDTGISRR
IR
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgatcttgcatttgttcgcattgggaacgatcgttgttcttgccagtggctatgcgctg
cccacccgtgaggctgagcgtggcatgcatccagtgtacaaggcagatgccgcagagctg
cgttccaagcgtgccagcatgccggtgatgacgtttccctcgttgaaggtggaacagtat
gcggaatattggcgtagcattgccaaccagacgctggaacagcagctggagagcaagatg
cgattgaacacacagttggccaagaatataatgctgttcctgggcgatggcatgtccata
ccgacaataacagcgggccgagtctatctggggggcgaggagaagcagtttgccttcgag
cagttcccctacgtcggcctgagcaagacgtactgcgccaatatgcaagtggcggattcg
gcgtgcaccgccacagcttatctgtgtggcgtcaaggccaattatggcactgtgggcgtc
acggcagcggtgcacatgaaggactgctttgcgcaatcgcagccggagcatcaggtggcc
tccattgccgagtgggcgcagcggcaaggcatggccacgggcctgatcacaaccacatcg
gtgacacatgcctctccggcgggtatctatgcccacatcgccaatcgcaactgggagaac
gatgcggatgtccaagcggatggcgctgatcccagcgtctgtgcggatattgcctcccag
ctggtgtatggtccagttggccaaaatctgaatgtgattctcggcgggggacgtgagaat
tttctacccgaacatgttcgggacacaagtggccagctgggtcgtcgcaaagacggacgc
aatcttatcgaggagtggcggcgtcagcacaccaacagtgcccactacgtatacacacgt
cgccagctgctggaactgtccaaccagacgtcccgagtgctcggcctattcgcaccatat
catatgccctatcatctcgattcgaatgccgaggagctgcccactttggaggagatggtg
caggcagcgatggacatactggagcgccagagcggcggacgtggctactttctgttcgta
gagggcggtcgcatcgatcatggtcatcacgatacgttggccctgcgagccattgatgag
accgctgagttcgacaagtccgtgcgctgggcacggacacacagcagcgtggaggatacg
ttgattgtggtgacatcggatcactcgcataccatgtcgctggccgggtattccagtcga
aagaacgatatatttggcatcaatgatgggcaactggccgccgatgatttgccgtatgca
acattaagctatgccaacggacccggctacaacagcaactatctgcgtgagggaggcgcc
gtcaagcggaagaatctgcgtgccatcaacatgaagaacaaagatttcatgtttccgacg
gcggtgccactcgagtcggagacacatggcggcgacgatgttgccgtcttcgccagtgga
ccctatgcccagctcttctccggcgtctacgagcagcacttcatcccccatgcgatggct
tatgcctcctgtttgagtgaatcgcgtagcatgtgctcggatacggggattagccggcga
atacgttaa

DBGET integrated database retrieval system