KEGG   Drosophila grimshawi: Dgri_GH18547Help
Entry
Dgri_GH18547      CDS       T01061                                 

Definition
GH18547 gene product from transcript GH18547-RA
Orthology
K14554  
U3 small nucleolar RNA-associated protein 21
Organism
dgr  Drosophila grimshawi
Pathway
Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    Dgri_GH18547
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 930 aa AA seqDB search
MTHLKEEDTSAVADEQEARGVIKESSQIFRRNRALGYVSNQVPAVTRYVQRRRDTLLITC
IGRSFQVYTASHFRLLHVSGLHPDDITAMATDRLHTYTASNKCIYAWRAGKHIRHVYRGH
ERDVHLLLPFGRSLIAVDHSNVLKVWNIPTDDVYLDVPFKSDEFRITALAHPPTYVNKIV
LGSQQGQLKIMNIKKNSIVCTLSHHDCGITCIEPAPALDVVAIGHADGTIIVLNLKYDTV
LVAFKQEWGLVTGLTFRTDGPPILVSACRNGYMAFWNLEEHKLAGQLQAHEEQVATAICL
PSEPVVFTTSPDNSMKLFVFDMPDGGARQLRIREGHTKPPLCIRYHGGSGVSILSSGEDS
TLRVFSTISESLNKSMGRATYNQKATKKKNRFQYDKYGMPPIVEFTSDVAREKEWDNIAA
IHSGIIQTTTWTFNKNRMGEHRLVPTQFQNKQRSNFQCETTCIILTHCGNFVIIGYSSGD
VERFNIQSGLHRCSYGAPKAAHESAVRGLASDNLNQYVVTGCSSGLVKFWTFKGKTERPI
AVLRLADGVALMRHHRESAMLAIGLDTFKVYVVDMATRVVVRKFIGHTAKLNDLAFSPDS
RWLITAAMDSTIKVWDIPSSYMIDHFRVERPCISLSMSPSGDFLATAHVNLLGIYLWSNK
TLFSQISLRSMDPHEPAPYVGLPANVCDAMELEDAMQELGIDSSNEQNAELGEEINAKYE
TPKQLAPELITLSGLAASRWQNLLDLQLIKQRNKPKAPPKVPKQAPFFLPTVSGLELRFD
VANGAPSATDGSRIQQVSALNNLTAFGKLLETTATSNDFDAACKHITQLGPSMVDFEIKS
LHPEAGGTLLAMLQFLKLIEFMFSTNLDFELAQSYLSVYLRSHGLSLSESPEIVQSLRSV
SQAQQLAWERVESKLIYGIGVVSALRNFAR
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atgacacatctaaaggaagaggacacctcggccgtggcggatgagcaagaggcgcgtggc
gtcatcaaggagagtagccaaatatttcgtcgcaatcgcgccttgggctacgtgagcaac
caggtgccggcagtgactcgatatgtgcagcgacgtcgagacaccctgctgatcacctgc
attggacgctcttttcaggtgtacaccgctagccactttcgtctgttgcatgtgagtggc
ctgcatccggacgatattacggccatggccaccgatagactccacacttatacggccagc
aataaatgtatctatgcatggcgcgccggcaaacacatccggcatgtgtatcgtggccat
gagcgagatgtccatctgcttctgccttttggccgtagtttgattgctgttgatcatagc
aatgtgctgaaagtgtggaacattcccaccgacgatgtatatctggatgtgcccttcaag
agtgatgagttccgaatcacagcgcttgctcatccgcccacgtacgtgaataagattgtg
ttgggctcgcagcagggtcagctgaagatcatgaacattaagaagaacagcatcgtgtgc
acactcagtcatcacgattgtggtatcacgtgcatcgaacctgcgccggcattggatgtg
gtggccatcggacatgccgatggcaccatcattgtcctcaatctgaaatacgatacagtg
ctggtggccttcaagcaggagtggggcctggtcaccggcttgacatttcgcaccgatgga
cctccgattttggtgtcggcttgtaggaatggttacatggccttctggaatctggaggag
cataagctggccggtcaactgcaggcgcatgaggagcaagtggccaccgccatttgcctg
cccagtgaaccggtcgtcttcaccacatctcccgacaactccatgaaactcttcgtcttc
gatatgccggatggtggagcacgtcagctccgcatacgcgagggtcacacaaaaccaccg
ctttgtattcgctatcacggcggctctggcgtgtccatactctcatccggcgaggatagc
acgctgcgcgtcttctccaccatctcggagtcgctaaacaaaagcatgggccgagccacc
tataatcaaaaggcgaccaagaagaaaaatcgtttccagtacgacaagtatggcatgccg
ccaattgtggagttcacatccgatgtggcacgcgagaaggagtgggacaacatagccgcc
atacattcgggcattatacagaccacaacgtggacgttcaacaaaaatcgcatgggcgaa
catcggctggtgccgacacagtttcaaaacaagcaacgcagcaatttccagtgcgagacg
acgtgcatcatattgacgcattgcggcaactttgtcatcattggctacagcagtggcgat
gtagaacgcttcaacattcagtccggcctgcatcgctgcagctacggtgccccaaaagcg
gcccatgaatcggccgtccgtggcttggccagcgataatctgaatcaatatgtggtcact
ggttgctccagcggactggtcaagttctggacgttcaaaggcaagactgaaaggccaatt
gccgtgctgcgtctggcagatggcgtcgctctgatgcggcatcatcgggagagcgccatg
ctggccattggcctagacacctttaaggtctatgtggtggacatggccacacgggtggtt
gtgcgcaagttcattggacatacggcgaagctgaacgatctggccttcagtccggacagc
cgttggctcatcacagcggcgatggactcgacaattaaggtgtgggacataccctcctcc
tacatgatcgatcatttccgcgtggagcgtccctgtatctcgctgagtatgtcgccaagc
ggtgattttctcgccactgcccatgtaaatctgttgggtatttatctctggtcaaataag
acgctcttcagccagatctcgttgcgttccatggatccacacgagcccgcaccgtatgtg
ggtctgccggcaaatgtttgcgatgcaatggaactggaggatgccatgcaagagctgggc
attgacagcagcaatgagcagaatgctgaactgggcgaggagatcaatgccaaatacgaa
acgcctaagcaactagcacccgagctgattacgctatcgggtctggctgcgtcacgctgg
caaaatctgctggatctgcagctgatcaagcagcgcaacaagcccaaggcaccaccaaag
gtacccaaacaggcgcccttctttctgccaacggtatccggtctggagttgcgcttcgat
gtggccaatggtgcgcccagcgccacggatggttcccgcatccagcaagtgtctgccctt
aacaatctgactgcctttggcaagctgctggaaacgacagccacaagtaatgactttgat
gccgcttgcaagcacatcacccaacttggaccgtcgatggtggactttgagatcaagtca
ctgcatccagaagccggcggcactctgctcgcaatgctgcagtttcttaaactgatcgag
tttatgttcagcacaaatctcgactttgagctggcccaatcctatctaagcgtctatctc
cgctcccatggccttagtctaagcgaatcaccagagattgtccaatccctgcgcagtgtc
tcccaggcgcaacagttggcctgggagcgtgtcgaaagcaaactgatttatggcattggc
gtcgtctccgcactgcgaaactttgctcgctaa

DBGET integrated database retrieval system