KEGG   Drosophila grimshawi: Dgri_GH18640Help
Entry
Dgri_GH18640      CDS       T01061                                 

Definition
GH18640 gene product from transcript GH18640-RA
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
dgr  Drosophila grimshawi
Brite
Enzymes [BR:dgr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dgri_GH18640
Peptidases [BR:dgr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dgri_GH18640
Transcription machinery [BR:dgr03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     Dgri_GH18640
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 717 aa AA seqDB search
MQKKTGASKYRYNINNSRVDFSCVRCLCSLCSSYSYSVKVAKIRRKQQRKCDKNSVPQPQ
SAKRTKTKENSVDSTTSILSTGSGSASSSSSTTTAAASSTANNNKRCRAAADFVPGSRIL
LPTTRAAAAAASAAAAASAATTTTKAAAGETVGSVGLGVGGGGGSGGQLTKEPPLNAKHL
SVSVCLHTVHKLAADLHVDANADANCDAEVMSETGCRHYQSYVKEHSYDTFRVIDAYFAA
CVNRDAREKKAIHCNCFECGSYGIQLYACLHCIYFGCRGAHITSHLRSKKHNVALELSHG
TLYCYACRDFIYDNRSRDYALINRKLEAKDLQKSLGWQPWIPTPKETNLLLANARRRLVR
PNVTIGLRGLLNLGATCFMNCIVQALVHTPLLSDYFMSDRHDCGSKLTHKCLVCEVSRLF
QEFYSGSRSPLSLHRLLHLIWNHAKHLAGYEQQDAHEFFIATLDVLHRHCVKAKTEREHE
SKSNSASSGTGGGGTNSSSSSSSANANASHCYGQCNCIIDQIFTGMLQSDVVCQACNGVS
TTFDPFWDISLDLGETTTHGGVTPKTLIDCLERYTRAEHLGSAAKIKCSTCKSYQESTKQ
FSLRTLPSVVSFHLKRFEHSALIDRKISSFIQFPVEFDMTPFMSEKKNAYGDFRFSLYAV
VNHVGTIDTGHYTAFVRHQKDTWVKCDDHVITMASLNQVLESEGYLLFYHKNILEYE
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaaaaacaggagcatcgaagtatcgatataatatcaacaattcccgagtcgac
ttcagctgtgtgcgctgcctctgctcgctctgctcgtcgtattcgtattccgttaaagtg
gccaaaattcggcgaaaacagcagcgcaagtgtgataaaaacagtgtgccacagcctcag
tctgcaaaacgaacgaaaacaaaagagaacagtgttgatagcaccacaagcatcctaagc
actggtagcggcagcgccagcagcagcagcagcaccactaccgccgccgccagcagcaca
gccaacaacaacaaacggtgccgggcagcggctgactttgtgcctggaagccgtattcta
cttccaacaaccagagcagcagcagcagcggcgtcagcagcagcagcagcgtcagcagcg
acaacaacaacaaaagcagctgccggcgaaactgttggcagtgttgggctgggcgtcggc
ggcggcggtggcagcgggggacagctaacaaaggagccgccgctgaatgccaagcatcta
tccgtctctgtctgtttgcataccgtgcacaagctcgctgctgaccttcacgtcgacgcc
aacgccgacgccaactgcgacgctgaggtaatgtcagaaacgggctgccgacattatcag
agttatgtgaaggagcacagttatgacacatttcgggtgatcgacgcctacttcgctgct
tgcgtcaacagagatgcgcgcgagaaaaaggccattcactgcaactgcttcgagtgtggc
agctatggcatccagttgtatgcctgtctgcactgcatctattttgggtgtcgtggggca
cacatcaccagccatctgcgtagcaagaagcacaacgtggccttggagctgtcccatggc
accctttactgttatgcttgccgggacttcatctacgataatcggagtcgggattatgcg
ctaatcaatcgcaaactggaggccaaggatctgcagaagagtctcggctggcaaccttgg
attcccacgcccaaggagaccaacctactcctggccaatgcccgaaggcgtctcgtgcga
cccaatgtgacaatcggactgcggggtctgctcaatctgggtgccacgtgcttcatgaac
tgcattgtccaggcgctggtgcacactccactgctgagcgactatttcatgtcggatcgt
cacgactgtggcagcaagttgacccacaagtgtctcgtctgcgaggtgtcgcgtctcttc
caggaattctattcgggctcacgttcgccattgtcgctgcaccgtttgctgcatttaata
tggaatcatgcgaagcatttggccggctacgagcagcaggatgcgcatgagtttttcatt
gcaacactggacgtgctgcatcgccattgcgtcaaggccaagacggagagggagcacgag
agcaagagcaacagtgccagcagtggcactggcggcggcggtaccaactccagttcgagt
tcatcgagtgcgaatgcgaatgcatcgcattgttatggccagtgcaactgcatcatcgat
caaatctttacgggcatgctgcagagcgatgtggtgtgccaggcgtgcaacggcgtctcg
accacattcgatcccttctgggacatctcactcgatctcggcgagacaacgacgcacggc
ggcgtcacgccaaaaaccctcatcgattgcctcgagcgatacactcgcgccgagcatctt
ggctcggcggccaaaatcaaatgctccacctgcaaatcgtatcaggagtcgaccaaacag
ttcagccttcgcactctgcccagcgtcgtctccttccacctgaagcgattcgagcactcg
gccctgattgatcgaaagatctcctcgttcattcagttcccagtcgaattcgatatgact
ccgtttatgtcggagaagaaaaatgcttacggcgattttcgcttctctttatatgcggtt
gtcaatcatgtgggaacgattgacacgggacattatacggcatttgtgcggcaccagaag
gacacgtgggtcaagtgcgatgatcatgtgataacgatggcgtcgctcaaccaggttctc
gaaagcgagggttatttattattctatcataaaaatatactggaatacgagtga

DBGET integrated database retrieval system