KEGG   Drosophila grimshawi: Dgri_GH18858Help
Entry
Dgri_GH18858      CDS       T01061                                 

Definition
GH18858 gene product from transcript GH18858-RA
Organism
dgr  Drosophila grimshawi
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 284 aa AA seqDB search
MDAIKKKMQAMKLEKDNAIDKADTCENQAKDANSRADKLYEELRDLEKKFVQVEIDLVTA
KEQLEKANTELEEKEKLLTTTESEVATQNRKVQQIEEDLEKSEERSTTAQQKLLEATQSA
DENNRMCKVLENRSQQDEERMDQLTNQLKEARMLAEDADTKSDEVSRKLAFVEDELEVAE
DRVRSGESKIMELEEELKVVGNSLKSLEVSEEKANQRVEEFKREMKTLSVKLKEAEQRAE
HAEKQVKRLQKEVDRLEDRLFNEKEKYKAICDDLDQTFAELTGY
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcaagcgatgaagcttgagaaggataatgccattgat
aaggcagatacctgtgagaatcaagctaaggatgccaactcccgcgccgacaaactttac
gaggagctgcgcgatttggagaagaagttcgtgcaggttgaaatcgatttggtcaccgcc
aaggagcagctggagaaggccaacaccgaattggaagagaaggagaaactgttgaccacc
acggaatccgaggtagccacccagaaccgtaaggtccaacagattgaggaggatttggag
aaatctgaggagcgctcaaccaccgcacaacagaagctgttggaggccacacaatcggcc
gatgagaacaaccgtatgtgcaaagtattggagaatcgttcccagcaggatgaggagcgt
atggatcagttgaccaaccaattgaaggaagcccgcatgctcgctgaggatgccgatacc
aagtccgatgaagtgtcgcgcaagctggccttcgttgaagatgagctggaagtggctgag
gatcgtgtccgctccggtgaatccaagatcatggagctggaggaagaattgaaggttgtc
ggcaactcgctgaaatctctggaagtgtccgaggagaaggccaaccagcgtgttgaggaa
ttcaagcgcgagatgaagaccttgtccgtcaagttgaaggaggccgaacagcgcgccgag
cacgccgagaagcaagtgaagcgcctgcagaaggaggtcgacaggctagaagaccgtctc
ttcaatgagaaagaaaagtacaaagcaatctgcgacgatttggaccagacatttgctgaa
cttactggatattaa

DBGET integrated database retrieval system