KEGG   Drosophila grimshawi: Dgri_GH18902Help
Entry
Dgri_GH18902      CDS       T01061                                 

Definition
GH18902 gene product from transcript GH18902-RA
Orthology
K04461  
protein phosphatase 1B [EC:3.1.3.16]
Organism
dgr  Drosophila grimshawi
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 371 aa AA seqDB search
MGAFLDKPKTAKHNDQGAGNKLLFGVSSMQGWRCEMEDAYFAKARLGNSLEEWSFFAVFD
GHAGCKVSEHCAQHLLESIISTEEFKSGDHVKGIRTGFLRIDEKMRQLPEFTQEEEKCGG
TTAVCVFISSTQVYIANCGDSRAVLCRTGVPVFATQDHKPILPEEKERIHNAGGSVMIKR
VNGTLAVSRALGDYDFKNVKEKGQCEQLVSPEPEIFCQSRQDTDEFLVLACDGIWDVMSN
EDVCSFIYSRLKVTTDLVNIANQVVDTCLHKGSRDNMSIIIIAFPGAPKPTEEAIESERR
LEEQIEKITREEIASNKETDYVELLKCLQSKDDIEGLPPGGGLQSKYHIIERTFKAAFPD
KPCEQYAYDEL
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgggagcattcctggataaaccgaaaacagccaaacacaatgatcagggcgcgggcaac
aagctgctctttggcgtcagctcgatgcagggctggcgctgtgagatggaggacgcgtat
tttgcaaaggcgcgtctagggaattctctggaggagtggagcttctttgctgtcttcgat
ggtcatgcgggctgcaaggtatccgagcattgtgcccagcatttgctggagagcatcatc
tcgacagaggagttcaagagcggtgatcatgtgaagggcatacgcactggcttcctgcgc
atcgatgagaagatgcgacaactgcccgagtttacccaggaggaggagaaatgcggagga
acaacggccgtttgtgtattcatcagctcaacgcaggtgtacattgccaattgcggcgat
tcgcgagcggtgctgtgccgcaccggtgtgcccgtgtttgccacccaggatcacaagccc
attctgcccgaggagaaggagcgcatacacaatgcgggcggcagtgtgatgattaagcga
gtcaatggtacactggccgtgtcacgtgcccttggcgactatgacttcaagaacgttaag
gaaaaggggcagtgcgagcagttggtttcaccggaaccggaaatcttttgccaaagccgt
caggacaccgatgagttcttagtcctcgcctgcgacggaatctgggatgtgatgagcaac
gaggatgtatgcagtttcatctactcgaggctgaaagtgaccacagatctggttaatatt
gccaatcaagtggttgacacctgtttgcacaagggaagccgtgataatatgagcatcata
ataattgctttccccggagcaccaaagccaactgaagaagcaatagaatctgagcgacgg
ttggaggaacaaatcgagaagattacaagagaggaaattgcgagtaataaggaaaccgat
tatgtggaactgttaaagtgtctacagagcaaagacgacattgaaggtcttccaccaggc
ggcggcctgcagtccaaatatcacattatcgagcgcacattcaaggcggcatttccggat
aaaccatgtgaacagtatgcatatgatgagctatga

DBGET integrated database retrieval system