KEGG   Drosophila grimshawi: Dgri_GH19092Help
Entry
Dgri_GH19092      CDS       T01061                                 

Definition
GH19092 gene product from transcript GH19092-RA
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
dgr  Drosophila grimshawi
Pathway
FoxO signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dgr04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 366 aa AA seqDB search
MSACKIRKFYKLDINRTEWEVPEIYEQLQPVGSGAYGQVCKAKVRGTNTDVAIKKLSRPF
QSTVHAKRTYRELMLLKHMDHENVIGLLDIFHPHPPETALEDFQHVYLVTHLMGADLNNI
IKMQNLSDDHVQFLVYQILRGLKYIHSAGVIHRDLKPCNIAVNEDCELRILDFGLARPQE
FEMTGYVATRWYRAPEIMLNWMHYSQTVDIWSVGCIMAELITRRTLFPGTDHIHQLNLIM
EMLGTPPDDFLKKISSENARNYINSLPPMKRKDFKVMFENANPLSVDLLEKMLELDADKR
ITAEEALAHPYMQKYAEPSDERTSPFYDQSFEDENFSLEKWKELVYREVVSFKPPASFAD
VLENIK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcgtgcaaaatacgaaagttttacaaattggacattaatcggactgaatgggag
gtgcctgagatatacgaacagctgcagccagtgggatctggtgcctacggacaagtgtgc
aaggcaaaggtgcgcggcaccaacacagatgtcgcgatcaagaagttatcacgacccttc
cagtcgacagtgcacgccaagcgaacatatcgtgaactaatgctcttgaagcatatggat
cacgagaatgttatcggtctgctcgatatttttcatccgcatccgccagaaacggcactg
gaggactttcagcatgtttatctggtgactcatttgatgggtgccgacttgaacaatatc
atcaagatgcagaacctatccgatgatcatgtccagtttctggtctatcaaatattgcgc
ggtctcaagtacattcacagcgctggcgttattcatcgggatctgaagccatgcaacatt
gccgtaaatgaggattgtgagctgcgtattctggattttggtctggcgcggccacaggaa
ttcgagatgaccggctatgtggcgacacgctggtatcgtgcacctgaaatcatgctcaac
tggatgcactacagccagacagtggatatttggtcggtgggctgcatcatggcagagttg
attacgcgtcgaactctctttccgggaaccgatcacatccatcagctgaatctaatcatg
gaaatgttgggcacaccgcccgatgatttcttgaagaagatctcctcggaaaacgcacgc
aactacatcaactcactgccaccgatgaagcgaaaggattttaaggtcatgtttgagaat
gctaatccactgtcggttgatctgctagagaagatgttggaactagacgctgataagcgt
attacggccgaggaggcactggctcatccatacatgcagaaatatgccgagccaagtgat
gaacgcacatcgcctttttatgatcaaagttttgaggatgagaatttctctttggagaaa
tggaaagagctcgtctacagggaagtcgtgagctttaagcctcctgcatcgtttgctgac
gtcctggaaaatataaagtga

DBGET integrated database retrieval system