KEGG   Drosophila grimshawi: Dgri_GH19097Help
Entry
Dgri_GH19097      CDS       T01061                                 

Definition
GH19097 gene product from transcript GH19097-RA
Orthology
K03259  
translation initiation factor 4E
Organism
dgr  Drosophila grimshawi
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dgri_GH19097
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dgri_GH19097
Translation factors [BR:dgr03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Dgri_GH19097
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 223 aa AA seqDB search
MSMEKVASKQYESKIWPDLVDSDDSDVENEIDVDKLPPLDVGPNENRLQHTYCLWFSRKG
TQRAASDYSKSLHVVGRCASVQQWWSLYSHLIRPTSLKPYRELSLFKQGIKPMWEDPANS
KGGQWVIRLRKNKIERAWENVCMAMLGEQFLVGDEICGIVLQTKFPEDSLSVWNRTATDM
TSTTRIRDTLRRILNIPLTTAMEYKIHCDSLKYVSINKGALKS
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgagcatggagaaggtggcaagcaaacaatatgaatcgaaaatctggccggatcttgtc
gacagcgatgacagcgatgtggagaacgagatagatgtggacaaattgcccccactggat
gtggggccgaacgagaaccgcctacagcacacatattgcctgtggttctcgcgcaaggga
acgcaacgggctgctagtgattatagtaaatcgctgcacgtggttgggcgttgtgccagc
gtgcagcagtggtggtcactctattcgcatctcattaggccaacgtcgctgaagccctat
cgggagttgagtctcttcaaacagggcatcaagccaatgtgggaggatccggcgaatagt
aaaggcggacaatgggtaatacgattgcgaaagaataaaatcgagcgggcctgggagaac
gtttgcatggcaatgctcggtgagcagtttcttgttggcgatgaaatctgcggtattgtg
ctgcaaacaaagtttccggaggatagcttatcagtatggaatcggactgccactgatatg
accagtacaacacgtatccgtgatacgttacgcaggatattaaatatacctctaacaact
gcaatggagtataagatacactgtgatagccttaaatacgtttcaattaataaaggcgca
ttgaaaagctga

DBGET integrated database retrieval system