KEGG   Drosophila grimshawi: Dgri_GH19131Help
Entry
Dgri_GH19131      CDS       T01061                                 

Definition
GH19131 gene product from transcript GH19131-RA
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
dgr  Drosophila grimshawi
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dgri_GH19131
Enzymes [BR:dgr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Dgri_GH19131
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 480 aa AA seqDB search
MTTTAVLGGGISGLSAGYYLLRRFGKPLTIYEASPRVGGWIRTEWHKERGFIFETGPRTI
RPKGVAGANTLELVEQLKLPVKPIRSSHVAARNRMLYAKGQVCMLPNSPKGLIATVPPFT
KPLYRALLHDLTTGGTVAKNEDESIYSFAERRFGKEIADYAISPMICGICAGDAREISVR
FLMDSLFEKEQKYGGVIKGVLYSRLNKNEDKDKDVDRPIDEPSNLYKQAVQEKWAMYSLT
DGLEQLPRALRKYLGEHDVNVQLSSRCNNLSFSSDGARLGLRNAELPVSHVVSSLPAYQL
APLVRQQHPSLCAQLLEIPYVDVVVVNLQYNSDQLLKQNGFGLLVPPVENLPVLGVIFDS
CCFDMAGNTILTVMMGGKWFEQWFGHQPSQKELRDTAQQHVRKILNIKEEPTFSRVHLLH
KCIPQYTVGHKRRVQQIRDYIRNYKLPLSLCGAAYDGVGINDVILSARRQVELLPMPQTH
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgactacgacagccgtactcggcggcggcatcagtggattatccgccggttattatttg
ctgcgccgctttggcaaacctttgaccatttacgaggcatcgcctcgtgtaggcggctgg
atacgcacggaatggcacaaggagcgcggcttcatcttcgagactggaccacgcacaatc
cgacccaagggtgtggctggtgccaacacattggagttggtggagcaactgaagctgccg
gttaaaccaatacgcagctcccatgtggcggccaggaaccgcatgctctatgccaagggt
caggtctgtatgctacccaacagtccaaagggtctgattgccacggtaccgccttttacc
aagccgctgtatcgagctctgctccatgacctgaccacgggcggcactgtggccaaaaac
gaggatgaatctatctatagctttgccgagcggcgatttggcaaggagatcgccgactat
gcgatcagtccaatgatatgtgggatttgtgccggagatgcgcgcgagattagcgtgcgc
tttctcatggacagtctcttcgagaaggagcaaaagtatgggggcgtcatcaagggcgtg
ctctactcgcgcctcaacaagaacgaggacaaggacaaggatgtggataggccaatagat
gaaccgagtaatctgtacaaacaggcggtgcaggagaagtgggctatgtacagcctgacc
gatggcctggagcagctgccacgcgccctacgcaaatatctcggcgagcacgatgtgaac
gtccagctgagcagtcgctgtaacaatctgagcttcagcagcgacggtgcacggctcggt
ctacggaatgcggagctgcccgtgtcgcatgtggtcagctcgttgccggcgtatcaatta
gcgccgctggtgcggcagcagcatccatcgctgtgtgcccaactgctcgagatcccttat
gtggatgtcgttgtggtcaatctgcaatacaacagcgatcagctgctcaagcagaatggg
tttggtctgctggtgccgccagtggaaaatttgccggtgctgggggtgatcttcgacagc
tgctgcttcgacatggcgggcaatacgatcctcaccgtgatgatgggcggcaagtggttc
gaacagtggttcggccaccagcccagccagaaggagttgcgcgacacggcccagcagcat
gtgcgcaagatcttgaacattaaggaggagccgacatttagtcgcgtccacctgctccac
aaatgcattccccaatataccgttggccacaagcggcgtgtgcagcagattcgggattac
atacgcaactacaagttgccattgtcgctgtgtggtgctgcctacgatggcgtcggcatc
aacgatgtcatcctctctgcccgtcggcaggtggagttgctccccatgccacaaacgcac
tga

DBGET integrated database retrieval system