KEGG   Drosophila grimshawi: Dgri_GH19134Help
Entry
Dgri_GH19134      CDS       T01061                                 

Definition
GH19134 gene product from transcript GH19134-RA
Orthology
K11853  
ubiquitin carboxyl-terminal hydrolase 34 [EC:3.1.2.15]
Organism
dgr  Drosophila grimshawi
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 3968 aa AA seqDB search
MCEVCADFQNLLELYEVRVASSELKFQLLLKSEIETTFNYIQSWPQRQCMCLYRDNKNYD
RFNLVVQSLICLTVQHLKHIDHLIDSYKRLTASAAQVVAQAQRKPPAPEREAHNDNDSES
ENKSKEQLASSSSLSSSSPTSARAADENKAKLADGSGDEEKRASGDGPGPPKKPPTTPPL
PAPPSSTKSHPQYTEEPWILPEVEKLLVLVSKVFLLNFPLYIAHKHGMHSRLDDLQADEA
HHLALICDLHDNDLPIYLLRNVSLFCNSGGFGAMSLCFEHPDLPVSTAHSMTATVSNVKL
WLNYHCNTQLFVPLRSRILQYMCKLSDQNLRSAATRAMADFVWSSMRDPLDVAVNFDTEG
LALAFKYFTSTTLTMRLAGMAQINAHINLFNEICTTETVNEVELFGQRIANWLTENQIVQ
HLFGPNLHVEIVKQAHVLLNFLAVENQISEEDIKLIWQATQLKHCSKTIFDILPALVKNL
APRPAMHLYSLLCRMDPKEHTEQSIYIASALTKLIWTRDCTRSQMNLMQDHLLGSNVTAS
SSDSGSIEGSNTEDDHVGADDSSIASGGGGGGVSGGGGGGHKSPVDGVTPCKQARHRRHI
CDPTTEKVKQLSGEDMAKVDIKNHRIVNIIDNTSSEEELQSRAALELQMHRKKTSNKRRR
PKASSNKQQQLLLPHELVEIWDGAEDVPSSDDGDADGDGELLADSDECSDGAGHQLVPAA
VLKHLHGEGPYIRAIAETNISELLSGAENDGSYSSPMSNKSEKNLADFDDEDVSPCEEEL
AQLVNSHVGRVTAPNCDVAPGFAAAAAVALMAVQSAVAMQKSGESNVAVAAAAVAAAAVA
TGNAQQSLAAMRHQANAAAAAAAAAAAKSKSDSDVDLMEGSNKQQHSPKAANNQPSFKLN
DVCQPGNTLLWDLLQDDKIGQLGESLALEAEKALATLLCFSMDRQLRTKFIEGCLQNVAN
NRSVIVSLRLLPKLFASFQQFRQSDTHTMTMWAERNHRMMQCFFNNIRHYARRHAELLIN
QNGEQQQQQLGLQLYSHKTQVSVRLQFLSSIFSSVGSPKNFRLTLDQLDALWEWLAHDPE
CSDCYFSWLQAQTKGGDQHALGIDALQHLYLKKLPELRPEEFSMVALGLFQQLCSFARIA
MAEYEKHSDAITANSSAVGMYHLWQIALRAQSNEVSLAAIQYINMYYMGQQLRLEKEFVS
QCMDNLVQAATALECIEDENALMRVQRGLLLLNTHLDTFRRRYAFHLRRWAIEGKGIGSH
SNLKNEGAGPPLRIVLQQAGLSEKSLLQMHACDLIADLKAEVSKWWESLQSGMTAPVLGL
LLSDGPLRIITQGQELTSDYDERTLGDAGFKDNQIVYVSLGGRGARRKETNVEHPSMLPP
PPKECLPTVLLLQPKYFEKLFCLMQTLGDMKPQSSTVHLQHHTKAQLLSRRVWDILAMLP
TNPHILDAFKNLVNDLNELQQLDAVGDQEQLANKRKQIKQKFNELLDPSNLQKFMYSLHI
VESLALSSAPRQAAAAGAAATGSNGSLVIVEQPRLKKGTNRRHNSNEQPPEPKRSSSSSD
CSKELIGCSELDTTTTTQPSTPRSGSDADVTEFQSSGGDKENHPKQISKRQKKIDAPIEL
ERPIGCVTPPPPPAAPAAAATILPAATAAAPVRSVLLGESSKWSEAFIKCGGLQHLYEIF
SGGQLQQSAHAKELALNEWRHDCLASLLRILWLLGFEELQTQDAHVLMSRPHAFMLQLME
VPQCLQRLSSILSDEVHQHLSTGATSLVFPYQFHQLRTGFWGRAQLVQFTMNILVSFVHA
SSEARRLLWSQPEQCTWLQKFILEDPEPAVRREICAGLYRICLGNAQSYRLLLAPLLHKL
IALLPRAEQMSSSVQHTQFLLSEEGKEPYGPACRDYFWLLARLVDTLTPEMVAEERIDIE
LLCESISESILGRDYHELRHGYQDDGLVGLLNLMSNLIKYDTSYKYRTKALSFIEQLIEF
LFEMPSPANRQKPKCKSATSRAAAYDLLVELSRGCATNYGYLHGRLLAQHKSGPKQPYPW
DYWPRDEGRAECGYVGLTNLGATCYMASCIQHLYMMPQARAAILRLPPAGAQKHAPTLLE
LQRMFAYLLESERKAYNPRSFCRVYQMDHQPLNTGEQKDMAEFFIDLVSKLEEMTPDLKH
LVKRLFCGTLSNNVVSLDCGHVSRTAEEFYTVRCQVADMRNLQESLDEVTVKDTLEGDNM
YTCSQCGKKVRAEKRACFKKLPQILCFNTMRYTFNMVTMLKEKVNTHFSFPLRLNMCHYV
EKTLMPQQYKEDREKRKREDLEAAENEKAEATLDADIEECYEYELVGVTVHTGTADGGHY
YSFIKERTKSNYHPHERWFLFNDAEVKPFDPSQIAAECFGGEMTSKTYDSVTEKYLDFSF
EKTNSAYMLFYERRLPEHLQRRHSELLATPTPSPTNEDKPEAEEPLKAETLINNNKKDST
NEDEAHPPLKAQPLEKERDESQTEKLQPEQQQEESAKNDDEKKGEEEQITANCDNLKSNN
NKEQPQASTSKGAVVAEAKVSTKPQQFRPLLSKELEDWIWQDNRQFLQDRNIFEHTYFNF
MWQICGHIPQTLISDTDVTCMAAKLSVSFFIETFIHAKEKPTMVPWVELLTKQFNASEEA
CEWFLSHMSVEPFWPVQVLIQCPNQMVRQMFQRLVVHVIQRLRATHADLYLGVETDENDR
ELIGQASCVTRFISSLISLLEHGARSHLRHLSEYFSLMCEFSRMGDEEALFLLRIGVLKS
LVDFYLGHKQTDSIDISSDNEDNSSDEALSVEKMRPASLDKMIALCASLVERSRGADFRL
RLSPKDFNAIAGGKGFPFLYQQIKDGINPHQTKHLIHALCRWDDRLATQIISMLFASVTK
HTELCAPFFKLLTLLTETQGGPVGLPCFTQLVLPRMWDAAEYCPQSVLDWLSLQATKNKI
AHAWILQSAEQWLEQFLLAHDNTRVRNAAACLLVALVPSQPFRANFRAHSQHKLLALNPH
SYRDINSDAQVVLHQVITLLLRLLRPARVYADIGAHGTTKLTAYFNLLSYCMVSKTEKLM
IGSFMRSLWELFHPRLSEPSVPAHHNKHALLTFWHHSLVDCPENAAMVANCPEITRNIAF
NYILADHDDAEIVTYNRSMLPAYYGLLRLCCEQSRALTRQLAQHQNLQWAFKNITPHPTQ
YAAAVDELFKLMALFATRHSDASEQEKLDVIAFRRSVIVAYTSSLDARVSWSTLISALKI
LVDNDDDRMLVIYNGGIEMCFEALHTLHSMHHEATACHVAGDLLDLLGEMVLLLATLRMR
TDNPAQKKQQQQQLEQQLQLQQQQLLQKQQQTQCTQAPQTPQQKEKQLQQQMQQHLQLQQ
MQLQQQHFLRQQHQHSALAKALPDAIKRLATLLNTFNSPEISRMALEVLKELVRNTSLEA
TSILAPILINCHLSVANAPNAIGPLGPYFPRRGAKQTPWPLGAKNSPRPPRPMVQMCIAL
SELAPRGLDTEYDAQVDAFYRPYHDFIDVMLRMCINTGTLNDTLVKLHCLVAIESTPLHF
NYFPKFWVGIHNNALTHKYSELLVKNPLLIEYLHNVLRDERSMLKDTFVREFLELYYHKV
AAQLPVARMIYTINYGMHSKDDIEELCGDLFAIRIIAQATGVPTSVRKELRGSLRALLNK
SERFQKEVERDQFPNKKQKRESGKEKEQTSSAGQSEAETADNSPDGKEKVESVDKISTAD
VSMEMPSDSAVGADDAAPAAVAVSVAATEPATPAADYADEHMASPASEKQEKGSIPSSDD
ETELEDELEPTPKRNKKSANKKTAHDRANEERKRRLSNLLSMESYIQSIFTIIKRDGGNA
SNAAAPSSRELPSEELPVEASTSAAAAAAIRARPKGATTPPEPEDDILQGNYNFEIDTSE
MNLHATLPLKSKSVNGQDQDQDQEAADTFNESLPAATAAVVNSVVPPISAAAGSVVASTS
QAASPTQI
NT seq 11907 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgaggtttgcgccgatttccaaaatctattggagctgtatgaggtgcgcgtggcc
agttcggagcttaagtttcagctgctgctaaagagcgaaattgagacgacattcaactac
attcagtcgtggccacagcgtcagtgcatgtgcttgtatcgtgacaacaagaactatgat
cgtttcaatctggtggtgcagtcgctcatctgtctgacggtgcagcatttgaagcacatc
gatcatctgatcgacagctataagcgtttgactgccagcgcagcgcaggtggtcgcccag
gcgcaacggaagccaccagcaccggaaagggaggcacacaacgacaatgacagcgaaagc
gaaaacaagtccaaggagcagctggcgtcctcgtcgtcgttatcatcgtcatcgccgact
tctgcccgcgccgctgatgagaacaaagccaagcttgcggacggcagcggcgatgaggag
aaacgtgcctcgggcgatggccccggaccgccaaagaagccaccaacaacaccgccactg
ccagccccaccaagtagcaccaaatcacatccacaatacaccgaagagccatggatactg
ccggaggtggagaagctgctcgttctcgtttccaaggtatttctactcaactttccgctg
tacattgcccacaagcacggcatgcactcccgcctagacgatctacaggctgacgaagcg
caccacttggccctaatctgcgatctgcacgacaacgatctgcccatctacctgctgcgc
aacgtgagtctcttctgcaattcgggcggctttggcgccatgtccctctgcttcgagcat
cccgatttgcctgtgtccacggcacactccatgactgccacagtgtcgaatgtgaagctc
tggctcaactatcactgcaacacccagctctttgtgccactccgcagccgcattctgcag
tacatgtgcaagctatccgatcagaatctgcgttcagcggcgacgcgtgccatggctgac
tttgtgtggtcctccatgcgggatcccctcgacgtggccgtcaactttgataccgagggc
ctggcgctggctttcaagtatttcacatccaccacactgacgatgcgtttggcgggcatg
gcgcagatcaatgctcacatcaatttattcaatgagatctgcacaacggagacggtcaat
gaggtggagctgtttggtcagcgcattgccaactggctgacggagaatcagattgtgcag
catctgtttgggccgaatctgcacgtggagattgtgaagcaggcgcatgtacttcttaac
ttcctggccgtggagaatcagatctccgaggaggacatcaagctaatttggcaagcaacg
cagctgaagcactgctcgaagaccatatttgatattttaccggcactcgtaaagaatctg
gcaccgcgtccggccatgcatttgtattcgctgctgtgccgcatggatcccaaggagcac
acggagcaaagcatttacattgcctccgccctgaccaagttgatttggacgcgcgattgc
acgcgcagccaaatgaatttgatgcaagaccatttgcttggctcgaatgtgacggcctcc
agctcggacagcggcagcattgagggtagcaacaccgaggatgatcatgtcggtgccgac
gacagcagcattgctagtggtggtggcggtggcggtgtcagcggaggaggtggtggtggt
cacaaaagtcccgtcgatggggtaacaccttgcaaacaggccaggcacaggcggcatatt
tgtgatcccaccaccgagaaggtcaagcaactgagtggcgaggacatggccaaggtggac
atcaaaaaccatcgcattgtgaacatcatcgacaacaccagcagcgaggaggagttgcaa
tcgcgagctgctctcgagctgcagatgcatcgcaagaagacgagcaacaagcgccgccgg
ccaaaagccagcagcaacaaacaacagcagctgttgctgccgcatgagctcgtcgaaata
tgggacggtgccgaggatgtgcccagcagtgatgacggcgatgccgatggcgatggcgaa
ctgctcgcagacagcgatgaatgcagcgatggcgccggccatcaactggtgcccgccgct
gtcctgaaacatttgcacggcgaaggaccgtatatacgtgccattgccgagacgaacatc
agcgaactgttgagcggcgccgagaatgatggcagttattcctcgcccatgagcaataaa
tcggagaagaatcttgccgacttcgatgacgaggatgtgtcgccgtgcgaggaggaattg
gcgcaacttgtcaattctcatgtgggccgtgtgactgccccaaattgtgatgttgcaccg
ggctttgcagctgccgccgctgttgctctgatggccgtacaatccgccgtggccatgcaa
aagtccggtgaatcgaatgtggctgttgccgccgctgctgttgccgcagccgctgttgcc
accggcaatgcgcaacaatcgttggcggccatgcgacatcaggcgaatgcagcggccgcc
gctgctgctgccgccgctgccaaatcaaagtcggactccgatgtggatctcatggagggc
agcaacaagcagcagcactcacccaaggcggccaacaatcagccctccttcaagctcaac
gatgtctgccagcctggcaatacgctactctgggatctgctgcaggatgacaaaattggt
caacttggcgaatctctggcattggaggcggagaaggcactggcgacgctgctatgcttc
agcatggaccgccagctgcgcacaaagttcattgagggttgtctgcagaacgtggcgaac
aatcgcagtgtgattgtcagcttgagattgctgccgaagctgtttgcgtcattccaacag
tttcggcaatcggacacacacacaatgacgatgtgggcagagcgcaatcatcgcatgatg
cagtgcttcttcaacaacattcgccactatgccaggcggcatgcggagctgctgatcaat
cagaatggggagcagcaacagcagcagctgggccttcagctatactcgcacaagacgcaa
gtttcagtgcggctgcagtttctgtcatcgatcttctcgtcggtgggctcgccaaagaac
tttcgcctcacgttggaccagttggacgcactgtgggagtggctagcgcatgatcccgag
tgctccgactgctatttctcgtggctacaggcgcaaaccaagggcggcgatcaacatgcc
ctcggcatcgatgccctgcaacatttatacttgaaaaagctaccggaactgcgacccgaa
gagttctccatggtggcgttgggcctgttccagcaactgtgcagtttcgcccgcatcgcc
atggccgagtacgagaagcacagcgatgccatcaccgccaattccagtgccgtaggcatg
taccacttgtggcagatcgcattgcgtgcccagagcaacgaggtctcgctggcagcgatc
caatacatcaacatgtactacatgggccagcagctgcgcctggaaaaggagtttgtctcc
cagtgcatggacaacttggtgcaggcggcaacagcattggaatgcattgaggatgagaat
gccttgatgcgagtacagcgtggcttgctgctgttgaatacgcatctggacacgtttagg
cgacgctatgccttccacttgcggcgctgggcaatcgagggcaaggggattggctcgcac
agcaatttgaagaacgagggcgccggtccaccgttgaggattgtgctgcaacaggctggg
ctatcggagaagagtctgctgcagatgcatgcctgtgatctgattgccgatctcaaggcg
gaggtgtccaagtggtgggagagcctgcagtcgggcatgacggcgccggtgctgggcctg
ctcttaagcgacggtccgctgcggataataacacagggccaggagctcacctcggactat
gatgagcggacgttgggcgatgccggcttcaaggacaatcagattgtgtacgtctcgttg
ggcggacgtggtgcgcggcgcaaggagacaaatgtggagcatccatcgatgttgccgcca
ccgccaaaggaatgcctgccgacggtgctactgctgcaaccgaaatactttgagaaactc
ttctgtctgatgcagacgctgggcgacatgaagccgcagtcgtcaacggtgcatctgcag
catcacaccaaggcacagcttttgtcgcgccgtgtttgggacatattagcgatgctgccg
acgaatccgcacattttggatgcgttcaagaatctggtcaacgatctcaatgagctgcag
caattggacgccgtcggcgatcaggagcagctggccaacaagcgcaagcaaatcaaacag
aagttcaacgaactgctcgatcctagcaatctgcaaaagttcatgtactccctgcacatc
gtcgagagcctggcgctgagcagcgcaccgcgtcaagcggctgctgccggcgctgctgcg
accggttccaatggcagtctggtcattgtggagcagccgcgtcttaagaagggcaccaac
cgccggcacaacagcaacgagcagccgccggagccaaaacggagcagcagcagcagtgat
tgcagcaaggagctgatcggctgctcagagctggatacgacgacgacgacacaaccatcg
acgccacgctccggcagcgatgcggatgtcaccgaattccagtccagcggcggcgacaaa
gagaaccatcccaagcagattagcaagcggcagaagaagatcgatgcaccgatcgagcta
gagcgtccaattggctgtgtgacaccaccaccgccgccagcagcgccggcggcagcagca
accatattgccagcggcgacagcggcggcgcccgtgcgcagtgtgctgctcggcgagagc
agcaagtggagcgaggcattcataaaatgcggtggactgcagcatctgtacgagatcttc
agcggcggccagctgcagcagagcgcccatgccaaggagctggcgctgaacgagtggcgt
cacgactgcctcgccagcctgttacgcatcctttggctgttgggcttcgaggagctgcag
acgcaggatgcacacgtgctgatgtcgcgaccgcatgccttcatgctgcagctaatggag
gtgccacagtgtctgcagcgtctctcgagcattctcagtgatgaagtgcatcagcatttg
tccaccggcgccacctcgttggtgttcccctatcagttccatcagctgcgtactggtttc
tggggacgcgcccaactggtacagttcaccatgaatattctggtgagctttgtgcatgcc
tcgtccgaggcgcgtcgtctgctctggtcccagccggagcaatgcacgtggctgcagaag
ttcatactcgaggatccggagccggcggtgcgccgtgaaatctgcgccggtctctatcgc
atctgtttgggcaatgcgcaaagctatcgtctgctgttggcgccgctgctgcacaagctg
atcgccctgctgccgcgtgccgagcagatgagctcctcggtgcagcacacccagtttctg
ctctccgaggagggcaaggagccgtatggaccggcgtgtcgagattacttctggctgctg
gcgcgactcgtggacaccctgacgcccgaaatggtcgccgaggagcgcatcgatatcgag
ctgctgtgcgagagcatctcggagagcattctcggccgggactatcacgaactgcggcac
ggctatcaggatgatggcctggtcgggctgctaaatctcatgtcgaacctgatcaagtac
gacaccagttacaagtacagaacgaaggcgctcagtttcattgagcagctcatcgagttt
ctgttcgagatgccctcaccggccaaccggcagaagcccaaatgcaaatcggccacatcg
cgtgccgctgcatacgatctgctcgtagagctgtcccgcggctgtgccaccaactatggc
tatctgcatggtcgcctgctggcgcagcacaagtccggacccaagcagccgtatccctgg
gactattggccacgtgacgagggccgtgccgagtgcggctatgtcggcctaacgaatctg
ggtgccacctgctacatggccagctgcatacagcatctgtacatgatgccacaggcgcgt
gccgcaattttgcgcctgcccccggccggggcacagaagcatgcgccgacgctgctggaa
ttacaacgaatgttcgcttatctgttggagtcggagcgcaaggcgtataatccgcgtagc
ttttgtcgggtctatcagatggaccatcagccgctgaatacgggcgagcagaaggatatg
gccgagttctttattgatctggtgtcgaagctggaggagatgacacccgatctgaagcat
ctggtgaagcgtctgttctgcggcaccttgagcaacaatgtggtctcattggattgcgga
catgtctcgcgcaccgccgaggaattctatacggttcgctgtcaggttgcggatatgcgc
aatctgcaggagtcgctcgacgaggtgaccgtcaaagatacgctcgagggcgacaacatg
tacacgtgctcgcagtgcggcaaaaaggtgcgcgccgagaagcgcgcctgcttcaagaaa
ctgccacagatactgtgcttcaatacgatgcgatatacgttcaacatggtcaccatgctc
aaggagaaggtcaacacgcacttctcatttccgctgcgtctcaatatgtgccactatgtg
gagaagacgctgatgccgcagcagtacaaggaggatcgcgagaagcggaagcgcgaggat
ctcgaggcagcggagaacgaaaaggctgaggcgacactggacgctgacatcgaggagtgc
tatgagtacgaattggttggcgttacagtgcacacgggaaccgcggatggtggacactat
tacagcttcatcaaggagcgcacgaaaagcaattatcatccgcacgagcgttggttcctt
ttcaatgatgccgaagtcaagccatttgatccctcgcaaatagcagccgagtgctttggt
ggcgagatgacaagcaaaacgtacgactcagtgaccgaaaagtatttggactttagcttt
gagaagaccaattctgcgtatatgctgttctatgagcgacgcttgcctgaacatctgcag
cgtcgacactcggagctactggcgacgccaacgccaagtcccaccaacgaggataagccc
gaagcggaagaaccccttaaagcggagacgctgattaacaataataaaaaagattccaca
aatgaggacgaggcgcatccaccacttaaggcacagccgctggagaaagagagggatgag
agccaaactgaaaagttgcagccagagcagcagcaggaagagtccgccaagaacgatgat
gagaagaagggagaggaggagcaaataacagccaattgtgataatttgaagtcgaataat
aacaaagaacaaccgcaggcgtcaacctcaaagggtgccgtcgtcgcggaagccaaagtg
tccacaaagccacaacagtttcgtccattgttgagcaaggagctagaggattggatatgg
caggacaatagacagttcctgcaagatcgcaacatcttcgagcacacctacttcaacttc
atgtggcagatttgcggccatataccacagacattaatctcggacacggacgtcacctgc
atggcggccaagttgtctgtgtcattttttattgaaacattcatacatgccaaggaaaag
cccacgatggttccttgggtggaattgcttacaaagcagtttaatgccagtgaagaggct
tgcgaatggttcctttcgcacatgtccgtggaaccattttggcccgtacaggtgctaatc
cagtgtccaaatcaaatggtgcgtcaaatgtttcagcgtctggtcgttcatgtcatacag
cggctacgtgcaacacatgctgatctgtatctgggcgttgaaacggatgaaaatgacagg
gagctgattggccaggcatcgtgtgtgacacggtttataagctcgctaatttcgctgctg
gagcatggagctcgctcgcatttgcgtcatttgtccgaatactttagcctgatgtgcgag
ttctcgcgcatgggcgatgaggaggcattgtttctgttgcgcatcggtgtactcaagagc
ctggtcgacttctacctgggccataagcaaacggatagtattgacatcagctcggacaac
gaggacaactcgtcagatgaagcgctttcagttgaaaaaatgcgtccagcgtcgctagac
aaaatgattgcactctgtgccagtcttgtggagcgttcgcgtggcgccgattttcgattg
agactgtcgccgaaagacttcaatgccattgccggcggaaagggctttccatttttgtat
caacaaataaaggacggcattaatccgcaccagacaaagcatttaatccatgcgctctgc
cgctgggacgatcgcttggccacccaaatcatcagtatgctcttcgcctcggtcaccaag
cacaccgagctctgtgcaccattcttcaagctgctcactttgctcaccgagacgcagggc
ggaccggttggcctgccctgcttcacccagctagtgctgccccgcatgtgggatgcggcc
gagtactgtccacagtcagtgcttgactggctgtcgctgcaggcgacaaaaaataaaatc
gcccatgcctggatactacagtccgccgagcaatggctggaacagtttctcctcgcccac
gataatacgcgcgtacgaaatgccgctgcctgtctgctggtggcgttggtgccctcgcaa
ccgtttcgggccaactttcgcgcccactcgcagcacaagttgttggccctcaatccgcac
agttaccgcgacatcaacagcgatgcccaggtggtgctgcatcaggtgatcacattgctg
ctgcgactactgcgtccagcgagggtgtatgcggacattggggcacatggcaccacaaag
ttgaccgcctattttaatctactcagctactgtatggtttcaaagactgaaaaactaatg
ataggttcgtttatgcgctccctgtgggagctgttccatccgcgtctctccgagcccagc
gtaccggcgcatcacaacaagcacgcactgctcaccttctggcatcattcgcttgtcgac
tgccccgaaaatgcggccatggtcgccaactgtccggagattacccgcaacattgcattt
aactatatacttgccgatcacgatgacgcggaaattgttacttacaatcggtccatgctg
cccgcctactatggactcctgcgtctgtgctgtgagcagagtcgagcactcacccgccaa
ttggcacagcatcagaatctacaatgggccttcaagaacatcacgccgcatcccacacaa
tatgcggccgctgttgatgagctctttaaactgatggcactgtttgccacccgccattcg
gatgccagcgaacaggagaaactggatgtcatcgccttcagacgctccgtcattgtagcc
tacacaagcagcctggacgcacgggtctcctggtccactctcattagtgcgctcaaaata
ctggtggacaacgacgatgatcgcatgctggtcatttataatggcggcattgagatgtgc
ttcgaggcgttgcacacgttacattccatgcatcacgaggcaaccgcctgtcatgtggct
ggggatctgttggatctgctcggggagatggtgctgctgctggccacgttgcgcatgcgc
accgacaatccggcgcaaaagaagcagcagcaacagcaactggagcagcagctgcaattg
cagcagcaacaattgctgcagaagcaacagcagacgcagtgcacccaagcgccacagacg
ccccagcagaaggagaagcagctgcagcagcaaatgcagcagcatctgcaattgcaacaa
atgcagttgcagcaacagcattttctgcgccagcaacatcaacactcggcattggccaag
gcgctgcccgatgccatcaagcggctggcaacgctgctgaacacattcaactcgccggag
attagtcgcatggcgctggaggtgctcaaggagctggtgcgcaacaccagcctggaggcc
accagcattttggcgcccattttaatcaactgccatttgtctgtggccaatgcacccaac
gcaattggccccttgggaccctattttccacgtcgcggtgccaaacaaacgccgtggcca
ctgggtgccaagaactcgccacgaccacccaggccgatggtgcagatgtgcattgccctg
tcagagttggcgccacgtggcctcgacaccgagtacgatgcccaagtggatgccttctac
aggccgtatcatgacttcatcgatgtgatgctgcgcatgtgcatcaacacgggcaccctc
aacgacactctcgtcaagctgcactgcctggtggccattgagtcgacgccgctccatttc
aactactttcccaaattctgggtgggcatacacaacaatgcactaacgcacaaatattcg
gaactgcttgtgaagaatccgttgctaatcgagtatctgcataatgtgctcagagatgag
cggagcatgctgaaggatacttttgtgcgagagtttctggagctgtactatcacaaagtg
gccgcacagctgccggtggctcgaatgatctacacgattaactatggcatgcactccaag
gatgacatcgaggagctctgcggtgatctctttgccatacgcattattgcccaggcgacg
ggtgtgccgacctccgtgcgcaaggaactccgcggatcgctaagggcgctgctcaacaag
agcgagcgctttcaaaaggaagtggagcgagatcaattcccaaacaagaagcaaaaacgt
gaatccggcaaggagaaggagcaaacgtcatcagccggccagtctgaggcagagaccgca
gacaattcgccagatggcaaagagaaggttgaatcggtggataagatcagcacggcggat
gtgtccatggaaatgcccagtgactctgctgtaggcgctgacgatgctgctcctgctgct
gtcgctgttagtgtcgctgcaacggaaccagcgacaccagctgctgactacgcggacgag
catatggcgagtcctgcttccgagaagcaagagaaaggatcgattccctcgtccgatgac
gaaacggaactggaagatgaattggagccgacacccaagcgtaataagaaatcggccaac
aagaagaccgctcacgatcgggccaacgaggagcgcaagcggcgtctgagcaatttgctc
tccatggaatcctacatacaaagcatttttaccatcatcaaacgagatgggggaaatgcg
tccaatgcagcagctcctagcagcagggagctgcccagtgaagagttgcctgttgaggca
tccacatcagccgctgctgcggcggcaatccgggccaggcccaagggtgccacaacgccg
ccggagcccgaggatgatatactgcagggcaattacaattttgagattgatacaagcgaa
atgaatttacacgcaactctaccgctgaagtccaagtcggtcaacggtcaggatcaggat
caggatcaggaggcggcggacacattcaatgaatcgctgccggcggcaactgcagctgtg
gtcaacagcgtcgtcccacccatcagcgccgctgccggcagcgttgttgcatccacttcc
caggcagcgagtccaacacaaatttag

DBGET integrated database retrieval system