KEGG   Drosophila grimshawi: Dgri_GH19166Help
Entry
Dgri_GH19166      CDS       T01061                                 

Definition
GH19166 gene product from transcript GH19166-RA
Orthology
K11424  
histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
dgr  Drosophila grimshawi
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:dgr00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1434 aa AA seqDB search
MQGIAKVNSIQGATDNATAGNVTPELAKSETESNSIQLQRLPRNLLLKQCLINDTESATD
SSEQFTEIKPHQSRVDPQKTPATGKSRRKRDLINLQSNLTAKYIGYANANSPTATTASES
TEQQMRTTRRRAHDTTLNSSSAELSGRDSDAASPKTLVTGILTARLGDAYLSPIDKLLIK
NGANSPNSTGFEADAEDVAAVQPSRKTIKRKLKRGLKPKTNKTKETEKTAAMEMERLPAD
QQELQLQPQLDQLPIETKRIVDNVEQEQVEIKIELGDENAADNIAYTELETEAMALEQTS
TESRQAEMIFALPETTATELDALKTPPDLIEPANNSEQSMKSPSSISLDSAKGLSIVTDS
GWPAYQMGDLCWGKLFTYCYWPCMICPDELGQIVGDQQTHPQRKSTDSVPGATVSIQVHV
HFFADNGRHNWIKSEFLLPFAGLKAYEELRESVRIQHGPRSFKYRQMVAKQSRQHVWRQA
IDEANIVAQIPYPERVQKFYEIHENNVTQSKQKRKQPKSIRGGDTSDVGSSLYDSTDNLN
GKPSAMQIVAVKRERSSSPFSPAFSPVKHNHQKRTKRRKLSGSVEQPMGFVSISEATDEK
PISMDLGDCEDPEFGQLFDAIKEYVTVHQNDDNNDKILMAVVNNIWYLKQLKLRDLSRNL
VDGDVELLGSAREESERGRGIYKIKRLSNRLKTMVLRRSITPIVMPSQQLATRADANQPE
RSHAVQAKVRKPVGRPIDEVIGDILLLDRKYLFRGLNREPICKYCHQPGGEIQRCSQQCN
TWLHAACLEQQMTESTKPTRGLKPIAAAIASQSLQPLTSSSPISDVEPLLKHITGDGVQT
EPEEAKEAIICVECASGKSDICCICYQQEMPVASLHNDGDGLTIAEMAQESTEKLMGCCQ
PMCNAKFHASCCKYWPQASVSNSSPTSRCPMHVCHTCVSDDPSGKYQQLNNSKLTKCVKC
PATYHQDSRCIPAGSQMLTLTHLICPRHNIAKADANLNVLWCYICVRGGELLCCETCPIA
VHAHCRNIPIKPNESYICEECESGRLPLYGEIVWAKFNNFRWWPAIILPPTEIPVNILKK
PHGLNDFVVRFFGTNDHGWISRRRVYLYIEGDTGDGYKNKSQMSKYYKIGVEEATHFLKI
IKAKRQEQAIGRLSGNKLHPPPYIKIKANKAVPPVRFVYSEESQNICVCKPDSEHPCGPE
SGCLNRILYHECNPKYCNAGKKCENQLFELRKSPRLEVVYMNERGFGLVCREAIAEGDFI
IEYVGEVINHAEFQRRVAQKTNDRDENFYFLGVEKDFIIDAGPKGNLARFMNHSCEPNCA
TQKWTVNCINRVGLFAIKDIPENTELTFNYLWDDLMNNGKKACFCGAKRCSGEIGGKLKD
EEVKESKVKQVPRQKGIRIQVAVPKRKAKKKSEIKHKTADNVPTSEDTGHRSRS
NT seq 4305 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggaattgctaaggtcaattcaattcaaggagctacggacaatgcgactgcaggc
aacgtcacgccagaattggccaaaagtgagacggaatccaactcaatacaattgcaacgc
ttgccaaggaatctgctgctgaagcagtgtctcatcaacgacaccgaatcggcaacggat
agcagtgagcaattcacggaaatcaaaccacaccagagtagagtcgatccacaaaagacg
ccagcaacaggaaaatcgcgcagaaaacgcgacttgatcaatctgcaatcgaacctgacc
gccaaatacattggctatgcaaatgccaactcgccaacagcaacaacagcgtctgaaagc
actgagcagcaaatgcgcacaactcgacggcgagcacatgacacaaccttgaacagcagt
agcgccgagctgagcggcagagatagcgatgccgcatcgccaaagactctggtcacgggc
attttgacagctcgccttggtgatgcctatctgagtcccatcgataaattgctgatcaag
aatggcgccaactcgcccaacagcaccggcttcgaggcggatgccgaggatgtggctgca
gtgcagccatcgcgtaagactatcaaacgtaaactaaaacgcggtctcaagccaaagact
aacaaaacgaaagaaactgaaaagacggcagcaatggaaatggaaaggttaccagctgat
cagcaggagctgcagctgcaaccgcagttggatcagttgcccatagaaacaaaacgcatc
gtagataatgttgagcaggaacaggtcgaaatcaagattgaattaggcgatgaaaatgcc
gcagacaatatcgcttacactgaactggaaactgaagccatggctttggagcaaacaagt
acagagagtagacaggctgagatgatttttgcgctaccagagacgactgcaacagagttg
gatgcactgaaaacaccgccagatcttatagagccggcgaacaatagcgaacaatctatg
aaatccccgtcgtcaattagtttggatagtgccaagggtttgtcgatagtcaccgattcg
ggctggcccgcctatcagatgggtgatctgtgctggggcaaattgttcacctactgctac
tggccttgcatgatctgtccagatgagctgggccaaattgtaggcgatcagcagacccat
ccgcagcgcaagtcaacggacagtgtgccgggagcgacggttagcattcaggtgcatgtg
cacttttttgccgacaatggacgccacaattggataaaatcggagtttcttttgcccttt
gccggccttaaggcctacgaggagctgcgcgaatctgtgcgcatccagcatggtccccga
agcttcaaataccgccaaatggtagccaaacagagcagacagcatgtctggcgccaagct
atcgatgaggccaacattgtcgcccagatcccatacccagagcgggtgcaaaagttttat
gaaattcacgaaaacaacgtcacacagagcaagcagaagcgcaagcaaccgaagtcgata
cgaggaggcgacacttcagatgtgggcagcagcctctatgattccacggacaatttgaat
ggcaagccgtccgctatgcaaattgtggctgtgaaacgggaacgttcctcctcgccgttc
agtccggccttctcccccgtgaagcacaatcatcagaagcgaacgaagcgacgcaagctg
agtggcagcgttgagcagccgatgggcttcgtttcaatttcggaggcaacggacgagaag
ccaatctcaatggatttgggcgactgtgaggatcccgagttcgggcagctattcgatgcc
attaaggagtatgtgacggtccatcagaatgacgacaacaacgacaaaattcttatggcg
gtggtgaataacatttggtatctgaaacagctgaagctgcgcgacctgagtcgcaacttg
gtcgatggcgatgtcgagctcttgggctcggctcgtgaggaatcggaacgcgggcggggc
atttacaaaattaaacgcctctcgaatcgcctgaaaacaatggtgcttcgccgcagcata
acgccaattgtgatgccatcacagcaattggcaacaagagcagatgctaaccaaccggaa
cgctctcatgccgtgcaggcgaaggtacggaaacccgttggtcgacccatcgatgaagtg
atcggggatatactgttgctggatcgcaagtacctgttccgcgggctcaatcgggagccc
atttgcaaatactgccaccagccgggtggagaaatacagcgctgttcgcaacagtgcaac
acctggttgcatgccgcctgcctggagcagcaaatgactgaaagtacaaagccaaccagg
ggccttaagccaattgcagctgctattgcaagtcagagtctccagccgctaaccagctcg
tcgcccatttcagacgtggaaccattgctgaagcacataactggcgatggcgtacaaacc
gaaccggaggaggcgaaggaagcgatcatatgtgttgagtgtgccagtggcaaatcggat
atttgttgcatctgctatcaacaggaaatgccagtcgcttcgctccacaacgatggggat
ggattaaccattgctgagatggctcaagaatcaactgagaagttgatgggctgctgccag
cccatgtgcaacgccaaattccatgccagttgttgtaagtattggccgcaagccagcgtc
agcaactcatcgcccacgtcgcgctgtccgatgcatgtgtgccacacctgcgtctcggat
gatcccagcggcaagtatcagcagctgaacaattctaagctgaccaagtgcgtcaagtgt
ccggcaacatatcatcaggattcgcgttgcattccggccggctcacagatgctaacgctc
acccatctcatctgtcccagacacaacattgccaaggcggatgccaatctgaatgtgctc
tggtgctacatctgtgtacggggcggcgagctcctctgctgcgagacctgccccattgcg
gtgcacgcgcactgccggaacattccaatcaagccgaacgagagctacatctgtgaggag
tgcgagagcgggcgactgccgctctacggcgaaatcgtttgggccaagttcaacaatttc
cgatggtggccggccatcatattgccgccgacagagatacccgtcaatatactgaagaag
ccgcatggcctcaacgattttgtggtgcgtttttttggcaccaacgatcatggctggata
tcgcgtcgacgcgtctatctttatattgagggcgacactggcgacggttacaaaaacaaa
tcgcagatgtcgaaatactacaagatcggcgtggaggaggcgacacacttcctcaagatc
atcaaggcgaaacggcaggagcaggcaattggtcgcttaagtggcaacaaactccatccg
ccaccctacatcaagatcaaggcgaacaaagcggtgccgcccgtgcgtttcgtttacagc
gaggagagccagaacatatgcgtttgcaagccggacagtgaacatccttgcggccctgaa
tccggttgcttaaatcgcatactctaccacgagtgcaatccgaaatactgcaatgctggc
aaaaaatgcgaaaatcaattgttcgagctgcgcaaatcgccccgtctcgaagtcgtttat
atgaacgagcggggctttggtctcgtctgccgggaggcgattgccgagggtgacttcatc
attgagtatgtgggcgaggtgatcaatcatgctgaattccagcgacgcgtcgcacagaag
acgaacgacagggacgagaacttttatttcctgggtgtggagaaggattttatcattgat
gcgggacccaagggcaatttggcccgtttcatgaatcactcgtgcgaaccgaactgtgcc
acacaaaagtggactgttaactgcattaatcgcgttggactgttcgctatcaaggacatt
ccagagaatacggaattgacgttcaactacttgtgggatgacctcatgaataatggcaag
aaggcctgcttctgtggcgctaagcgctgctccggcgagattggaggcaaactaaaggac
gaggaagttaaggaatcgaaggtgaagcaagtgccacgccaaaaagggattcgaatccag
gtcgccgtgcccaagaggaaagcaaaaaagaaatccgaaataaagcacaaaactgccgac
aacgtaccgacatcagaggatactggccacaggagtcgtagttaa

DBGET integrated database retrieval system