KEGG   Drosophila grimshawi: Dgri_GH19188Help
Entry
Dgri_GH19188      CDS       T01061                                 

Definition
GH19188 gene product from transcript GH19188-RA
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
dgr  Drosophila grimshawi
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dgri_GH19188
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    Dgri_GH19188
Enzymes [BR:dgr01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     Dgri_GH19188
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 324 aa AA seqDB search
MFPSPLQNYTKLNAPTAFSHEQQSPYEIVSKSYGKDAVKVLHVNRRGPVHTIQELEVGTH
LKLNSNKDYVLGVNSDVVATDSQKNTVYLLAKKYGVESPEKFALIVGNHFLSKYAHVEEA
HVHVEAYPWQRIHQKNQQSQPHNHAFLFSPTAEHYCDVIVRRQAPKQTVISGIRGLRVLK
TTQSSFVNFVDDEYRSLADQSDRIFSTVVECAWEYSCTKSVDFLSVWQTVKDIILKNFAG
DPNVGIYSPSVQNTLYLSEKDVLDVVPQVAVITMTMPNKHYFTFDTKPFQQVAPGENNEV
FIPTDKPHGTIHAVLGRKDLKSHL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtttccaagtccgctacaaaattacactaagctgaatgctcccactgccttcagtcat
gagcaacagagcccctatgagatagtcagcaaaagctacggcaaggatgcagtcaaggtg
ttgcatgtgaatcgcaggggaccagtgcacaccattcaggagctggaagtgggcacacac
ctcaagctcaacagcaacaaggactacgtgctgggcgttaactcagatgtggtggccacc
gattctcaaaaaaataccgtttatttgcttgccaagaaatatggcgtcgagagtcccgag
aaatttgctttgattgtgggcaaccacttcttgagcaaatatgcccatgtagaggaggct
catgtgcacgtagaggcttatccttggcaacgcatacaccagaagaatcaacaatctcag
ccgcacaatcacgcctttctcttttcacccactgctgagcactactgcgatgtgattgtg
aggcgtcaagctcccaagcaaacagtgatcagtggcattcggggactgcgcgttctgaag
accacccaatcgtcgtttgtgaattttgttgacgacgaatatcgctcgctggcagatcaa
agtgatcgcattttcagcacggttgttgaatgtgcttgggaatattcctgtacgaagtca
gttgattttctaagtgtctggcagactgtgaaggacattatactgaagaactttgccgga
gatccaaatgtgggcatctactcaccttctgtacagaacaccctgtacctgagtgagaaa
gatgtgctcgatgtggtgccacaagtggccgtcatcacaatgacgatgcccaataagcac
tacttcacattcgacacaaaaccctttcaacaagtagcccccggtgaaaataacgaggtc
ttcataccaaccgacaaaccacacggaaccattcatgctgtgttggggcgtaaggatctc
aagagtcacctctaa

DBGET integrated database retrieval system