KEGG   Drosophila grimshawi: Dgri_GH19192Help
Entry
Dgri_GH19192      CDS       T01061                                 

Definition
GH19192 gene product from transcript GH19192-RA
Orthology
K17610  
calcineurin B homologous protein 1
Organism
dgr  Drosophila grimshawi
Brite
Protein phosphatases and associated proteins [BR:dgr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Dgri_GH19192
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 189 aa AA seqDB search
MGNKSSLFLRHEEIAQIQNETGFTPNQIERLYSRFTSLDRNDCGTLSREDLMRIPELAIN
PLCERIVHSFFVESTDDRVNFRQFMNVLAHFRPLRDNKQSKLNSREDKLKFAFQMYDLDD
DGVISRDELLSILHMMVGANISQDQLTSIAERTILEADLCCQGKISFEDFCKALERTDVD
QKMSIRFLN
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacaaatcatctcttttcctgcgacacgaggaaattgcacaaatacaaaatgaa
acgggatttactcccaatcaaattgagcgtctttattcgcgcttcacctcgctggatcgc
aacgattgtggcaccctgtcgcgcgaagatctgatgcgcatcccggagctggccatcaat
ccgctgtgcgagcgcattgtgcactccttctttgtggagagcaccgatgatcgggtgaac
ttccgccaattcatgaatgtgctggcccatttccgtccgttgcgggacaataagcagagc
aaactgaatagtcgcgaggataagctgaagttcgccttccagatgtacgatctggacgat
gatggcgtcattagtcgcgacgagctgctctccattctgcacatgatggtcggtgcgaac
atcagtcaagatcagttgaccagcattgcggagcgtacgattctggaggcagatctgtgc
tgccagggcaagatctcgttcgaggacttctgcaaggcgctagaacgcaccgatgtcgat
cagaagatgtccatacggtttctcaattaa

DBGET integrated database retrieval system