KEGG   Drosophila grimshawi: Dgri_GH19291Help
Entry
Dgri_GH19291      CDS       T01061                                 

Definition
GH19291 gene product from transcript GH19291-RA
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
dgr  Drosophila grimshawi
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dgri_GH19291
   00670 One carbon pool by folate
    Dgri_GH19291
Enzymes [BR:dgr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Dgri_GH19291
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 184 aa AA seqDB search
MLKFNLIVAVCENFGIGFKGNLPWNLKSELKYFSRTTKRVCDPSKRNVVIMGRNTYMGVP
PSKRPLPDRLNIVLSTTMSAADLPKEVLLCRSLNEAMETIESPEWCKQVENVWIVGGSRV
YAEAMDSERFHRLYLTKIHEKFECDTFFPEIPDCFKEIPLDEHTPDGIQEEDGIKYEYKI
LEKQ
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgcttaagtttaatttaatagtcgctgtttgcgaaaactttggcatcggtttcaagggc
aatctcccatggaatctcaaatcggagctgaagtattttagtcgcacaacaaagcgcgtc
tgcgatccttccaagcgcaatgtcgtcatcatgggcaggaatacctatatgggcgtcccg
ccaagtaagcgtccactgccagatcgcttgaacattgtgctcagcacaacgatgtctgca
gccgatctgcccaaggaggttctgctgtgccgcagcctgaatgaagcaatggagaccatc
gagagccccgaatggtgcaagcaggtggagaatgtatggattgtcggcggcagtcgtgtc
tatgccgaagcaatggattcggagcgtttccatcgcctctatttgaccaaaatccatgag
aaattcgaatgcgacacattctttcccgaaatcccggattgctttaaggaaatcccactc
gacgagcacaccccagacggtatccaggaggaggatggcattaaatacgagtacaaaatt
ttggaaaagcaataa

DBGET integrated database retrieval system