KEGG   Drosophila grimshawi: Dgri_GH19421Help
Entry
Dgri_GH19421      CDS       T01061                                 

Definition
(RefSeq) GH19421 gene product from transcript GH19421-RA
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
dgr  Drosophila grimshawi
Pathway
dgr00040  Pentose and glucuronate interconversions
dgr00053  Ascorbate and aldarate metabolism
dgr00830  Retinol metabolism
dgr00860  Porphyrin and chlorophyll metabolism
dgr00980  Metabolism of xenobiotics by cytochrome P450
dgr00982  Drug metabolism - cytochrome P450
dgr00983  Drug metabolism - other enzymes
dgr01100  Metabolic pathways
Module
dgr_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dgri_GH19421
   00053 Ascorbate and aldarate metabolism
    Dgri_GH19421
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dgri_GH19421
   00860 Porphyrin and chlorophyll metabolism
    Dgri_GH19421
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dgri_GH19421
   00982 Drug metabolism - cytochrome P450
    Dgri_GH19421
   00983 Drug metabolism - other enzymes
    Dgri_GH19421
Enzymes [BR:dgr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dgri_GH19421
Glycosyltransferases [BR:dgr01003]
 Others
  Hydrophobic molecule
   Dgri_GH19421
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C MHCassoc_trimer
Motif
Other DBs
NCBI-GeneID: 6564334
NCBI-ProteinID: XP_001990567
FlyBase: FBgn0126886
UniProt: B4JG62
AA seq 510 aa AA seqDB search
MRLQQLPVGGLALATLLLLQHLCPSTRAARILFVFPFDMLSQCKLLTPYLLALHERGHQL
TIIHAFDCDTMKQFHSIFVKDRHDTDSDFDAHQWDTVSEWVVLMSIRNFFVKIVLNVLES
PEVQQLMHSNVSYDLVVLEPSNTDGLFGLAAHFNAILIGLGTCGSDWTMETFVGYRGSST
FEPVMWTGFNKGITLIERFYNWIRMSEEWMLYWLIFQPAQRAIHEHFFGHLEQSFEEIRQ
NFSLILLNQHFSFFEARASVPSMVDVGGMHVPKQLPTLPAELEQFIEEAQHGVIVMSLGP
EIKSKDLPAEKLRIIVDTFEALPQRIIWKFEGNVRPNVSSSIYMSEWLPQQEIVAHPNCR
LLISHGGILSIIEAAYYGKPVLGFPVFFDQFRNLERMQVEGMAQRLDISTLTRLEFETAL
REMLALPQYRRKALELSQRVRDQPMHPLDVAVFWTEYVWRHQGAPYMRVSTSKVKLFDYY
YLDNILGVLSRFGLLIGLVVYVLCKLFKWR
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgcagcagttgccggttgggggtctcgctcttgcaacactactgctgctgcag
cacctgtgccccagcacacgtgcagccagaatactgtttgtctttccgtttgacatgttg
tcacagtgcaagctattaacgccctatctgctggccttgcatgagcgcggtcatcagctg
accatcatccatgcctttgattgcgacaccatgaagcagttccactcgatattcgttaaa
gatcgtcatgacacagattcggattttgatgctcatcagtgggacaccgtttctgagtgg
gttgtactcatgtcaatacgcaatttttttgttaagattgttttgaatgttttggagagc
ccggaagtgcagcaactgatgcattccaatgtgagctatgatctggttgtgctggagcca
tcgaatacagatgggctctttggcctggcagcgcatttcaatgcgattctaattggactg
ggaacatgtggttccgattggactatggagacatttgtcggctacagaggatcatcaacg
tttgagccggtgatgtggaccggctttaataaaggcataacactgatagaacgtttttac
aattggatacgaatgtccgaagagtggatgttgtactggttaatctttcagccagcacaa
cgtgcgattcacgagcatttctttggccacctcgagcaaagctttgaggaaattcgacag
aacttttcgttgatattgctgaatcagcacttcagtttcttcgaggcacgagccagtgtc
cccagcatggtggacgtgggcggcatgcatgtgcccaagcagttgccaacactgcccgca
gagctggagcagtttattgaagaggcacaacatggtgtcatcgtcatgtctcttggtcca
gagataaagagcaaggatctgccggcggaaaagctgcgtataattgtggacacctttgag
gctttgccacagcgcatcatatggaaattcgagggaaatgtacgaccaaatgtgagcagc
agcatctacatgagtgaatggctcccacagcaggagatcgttgcgcatcctaattgccgg
ctgctcatcagccatggcggcatactgagcatcattgaggcagcctattatgggaagccc
gtgctcggatttcccgtcttcttcgatcagttccgcaacttggagcgcatgcaggtggag
ggcatggcacagaggttagacatcagcacgctgaccaggctggagtttgagacagcattg
agagaaatgttggccctgcctcaatatcgaagaaaggcgctagaactatcgcagcgtgtt
cgagatcagccgatgcatccactggacgtggctgtcttttggacggagtacgtttggcgt
caccagggtgcaccctacatgcgtgtgtccacctccaaagtgaagctatttgattactat
tacttggacaatatactcggtgttctttcgcggtttggactacttattggcttggtggtt
tatgtgctctgcaagttgtttaaatggcggtaa

DBGET integrated database retrieval system