KEGG   Drosophila grimshawi: Dgri_GH19436Help
Entry
Dgri_GH19436      CDS       T01061                                 

Definition
GH19436 gene product from transcript GH19436-RA
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
dgr  Drosophila grimshawi
Brite
Enzymes [BR:dgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dgri_GH19436
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 456 aa AA seqDB search
MARRRGFRLQLRKRKNNSIYKRKCRKRLLFRRYNYIHILRANLRGCRKTSTKMAQIQEYQ
DLVLDALETVEFKLIRDKADINNDALIFHPAMAHQIFGESETIFGYQGLHVRVLYTAGPL
HIYLGIEYEKRVNEISDGEIKADDVVATIAQSLPDGCYFINLDEFLKTLDKADKFQPFGE
KLSEYTQRADDGSERIFEIYQCDYKMSSFLKFFARLQTFILWFVDAASYIDTDDAQWCYF
ICYEKYKNKNGSFQYATAGYTTVYEYYAYPQNKRPRISQMIVLPPFQKLGLATELVKTIY
KFYQSQKNVVDITVEDPSEDFQRLRNFVDARLCLDLKCFAREEISQGFSKEMVREAREAL
KLNPRQVRKVYELLRLFYTNLNDEKEYKAYRLEVKKRLNAVYYKQIKDLQKMERYKMDTE
LLRARMPNNKQRIEQLQEEYELIEQDYKNTINKLRA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcagaagaggatttcggttacagctaagaaaacgcaaaaataacagtatttac
aagcgcaagtgtcgcaagcgtttgttgttccgacgctacaactacatacacattttgcgc
gccaatttgaggggctgcagaaagactagcaccaaaatggcacaaatacaggaatatcaa
gatctggtgctcgacgcactagaaacagtggagttcaagctgatacgcgacaaggcggac
atcaacaatgacgctttaatatttcatccagccatggcgcatcagatttttggcgaatcg
gaaaccatatttggctatcagggcttgcacgtgcgagtattgtatacggcgggtccgttg
cacatctatctgggcattgagtacgagaagcgtgtcaatgaaatttctgatggcgaaatc
aaagccgacgacgtggtggccaccattgcccaaagcctgcccgacggctgttattttatt
aatctggatgagtttcttaagacgttggataaggccgacaagttccagccgtttggcgag
aagctcagcgaatacacacaacgcgctgacgacggcagcgagcgcatttttgagatttat
cagtgtgattataagatgtcctcatttttgaaattctttgcgcgtttacaaacatttatc
ctgtggtttgtcgatgctgcctcctacatagacacggatgatgctcagtggtgttacttc
atttgctatgagaaatacaagaataagaatggatcgttccagtatgccacggctgggtat
accacagtctatgaatattatgcttatccgcaaaacaagcgaccacgcatcagccaaatg
atcgttttgccgccattccagaagctaggcttggccacggagttggtcaaaaccatttac
aagttctatcagtcgcagaagaatgtggtggatataaccgttgaggatccatccgaggat
tttcagcgcttacgcaattttgtggatgcacgtttgtgtctggatttaaaatgctttgca
cgcgaagaaatcagccagggttttagcaaggagatggttcgggaggcacgtgaggctttg
aaactgaatccacgccaggtgcgcaaggtctatgaactgctgcggctcttctacaccaat
ttgaatgatgaaaaggagtacaaggcgtaccgtctggaagtgaagaaacgcctcaatgcc
gtttactacaaacagatcaaggatctgcagaaaatggagcgttataagatggatacagaa
ttgctgcgcgcacgcatgccaaataataagcagcgcattgaacagttgcaggaggagtat
gagctcatcgagcaggattacaaaaatacaatcaataagcttcgtgcctag

DBGET integrated database retrieval system