KEGG   Drosophila grimshawi: Dgri_GH19675Help
Entry
Dgri_GH19675      CDS       T01061                                 

Definition
GH19675 gene product from transcript GH19675-RA
Orthology
K09186  
histone-lysine N-methyltransferase MLL1 [EC:2.1.1.43]
Organism
dgr  Drosophila grimshawi
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Dgri_GH19675
Enzymes [BR:dgr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Dgri_GH19675
Transcription factors [BR:dgr03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    Dgri_GH19675
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 3837 aa AA seqDB search
MGRSKFPGKPSKSINRKRISVLQLEDDAASSAAQQHQQGEQSTDSASRDKGNNCDNDDDD
NASSGAATSGATSGAAADTAGNGAGAGSGGSGGGGGGGGSGGGTTNGGNVNGGSHHKSAT
SEVKECKNQGNNIELNNSNAASGPDDAAEDTNNDDDDDSSTNDKRTTTATTTTAAAAVAL
VPQCLSALQRARKGGNKKFKNLNLARAEVMLPSTSKLKQQQQLQLNCPSSSSSSTAAAAV
AAPTTTTTTAATIASASATLAATSTSTSLSLSMPAVAAAAAGGGGGAAAGLLTNPFASAV
VVESNVAEEATGAGNEDAAMLKPSIEMANETATEAAVDASTATAAVVPSPNPNSVAASTI
SAATGTQPPATAIKQKKTVTFKNILETSDDKSVVKRFYNPDNRVPLVSIMKKDSMNRPLN
YCRGSEFIVRPSKLSKILNTYSNIDKLNSLKFRSVPVAMASSSSSSIQDSSSMSLFGSGL
SRAFGAPLADEDAVSGGVTFRKHEPQQKASDDNEDDGSASSDDIEDDDDMDEDDMEDNDE
AVSEKSAEPAASVNEMDVDDRQLEVDKSTVPPTRTRSSRIVKPNKRLLELGSLSSKKNSN
DAGVKAKPKNYFGLGGDFSGDTATATAPVSTSSSSSTSFPNFGTAKLNNSSFVLRQSRLQ
FPLDKSVSFAGLPTVSSAIAPANVQMSFGSLNNANSVVAMSCVVCGTPVSNKDAPLARKF
GVIACEVCRKFISRMTKISKSSTAMHSSSSSSSNAALTSQQVQCKGTDDTGGSCNIQSLK
SQLKNFKKLYKERCTACWLKKCLTAFQLPTAHRSRMSAILPANMRDEAAGKDDKGCPELL
SPTASLRFSAPTVAVSSSVGGTTIKWKSSAETTVSSIKSNPLAENNVTFGSTPILRPAIL
EKPLFLKIGNAVGDTKKTKESKIGAAAETAVGQTAVASSNEAAAPAKITRKAKQDKEKAS
REQESEKLLSPSAKKAIDAATTQETQKDEPQTTAAIAAPPPSQTSSTAAASINQVEAAEV
VASTSTSTVPDNLKRQRIDLKGPRVKHVCRSASIVLGQPLATFGDEDDELAAVESVQTAT
TTTNATPPEVTNPKKPKSPLPVQMMVTDENDNCATCKPVPSGDTAEAQPQPVVKGVLESK
SNKSNTNQSEAKKAAATAGAGASKGKVSTRNATSSVSSSANGLVASKKQRNIEASSNAGN
QATAAQSRRALAKEVNRLKALISTDFWENYDPAEVCQTGFGLIVTETVAQRALCFLCGST
GLDPLIFCACCCEPYHQYCVLDEYNLKHSSFDDTLMNSLLETSSISAITNTALTQLTQRL
NWLCPRCTVCYTCNMSSGSKVKCQKCQKNYHSTCLGTSKRLLGADRPLICVNCLKCKSCA
TTKVSKFVGNLPMCTACFKLRKKGNFCPICQKCYDDNDFDLKMMECGDCNQWVHSKCEGL
SDEQYNLLSTLPESIEFICKKCARRCDVSRNKAEEWRQAVMEEFKSSLYSVLKLLSKSRQ
ACALLKLSPRKKLRCSCAAGAAKTQSQGKLQPKALQFNYNGLGSDGESQNSDDVYEFKEQ
QSQANPKPTTPVPCSCLQPVTQSHSFSLVDIKQKIAGNAYVSLAEFNYDMSQVIQQSNCD
ELDIAYKELLSEQFPWFQNETKACTDALEEDMFESCGYEELEESPSTYAQEHAASQPPRV
GVLDIPLDDVDDLGSGCALKTRLDSRVCLFCRKSGEGLSSEEARLLYCGHDCWVHTNCAM
WSAEVFEEIDGSLQNVHSAVARGRMIKCTVCGNRGATVGCNVKSCGEHYHYPCARSIDCA
FLTDKSIYCPAHARNALKANGSPSVTYESNFEVSRPVYVELDRKRKKLIEPAKVQFHIGS
LEVRQLGSIVPRFSDSFEAIVPINFLCSRLYWSSKEPWKIVEYTVRTTIQNSYSTTLTLD
AGRNFTVDHSNPNCSLVQLGLAQIAKWHGSLARSDLLESDWAEFPNSYVPPDENTEEEPQ
QNADLLPPEIKDAIFEDLPHELLDGISMLDIFMYEDLDKTEFAMSEQSKDGTTPSLTQAA
GSASVTICDEDTRNSNSLSKQLELSNCWPASNPVEDAMLSAARSSNQAKQLKSKATAPTR
SWAKLDGSSVAALKRRKLSKNLTEGVLLSLNQRSKKEMATVAGITRRQSVCSSSNGEIST
DASAGMRTKSFTWSAAKRYFEKSESRDEPAKLKIMQMDGVDDSITEYRIIGGDGNLSTAQ
FTGQVKCERCQCTYRNYDSFQRHLPSCEPMSTSESESETTTAAAATQLSAESLNELQKQA
LAAATLTNGGGLNYLQTSFPQVQNLATLGQFGVQGLQGLQALQLQPQSLGNGFFLSHPNA
APATSNGNDELQLYANSLQSLAANLGGGFTLAQPTQAQPQLIALSTNPDGTQQFIQLPQS
TAGATQFQTAAPTLATTTTYQTLQATNSDKKIVLPLRGTGKPLKTVATKAAQQATAAAKQ
KQLKSAHGVKPIQAKLQPHPQQQQHHHQQQQQHQQQQQHTPITVATNGATQLLGQNLLQP
QLLFQSNAHPQAQQLLLPQTQAQNIISFVTGDGSQNQPLQYISIPTTNDFKPQQQTTTPT
FLTAAPGGGATFLQTDASGNLVLTTAPSNSGLQMLTGQLQTQPQVIGTLIQPQTLQLTTT
GADGTQSATTQQPLILGGNGAGGATGLEFATATPQVILATQPMYYGLETIVQNTVMSSQQ
FVSSAMPGVLSQNASFSATTTQVFQASKIEPIVDLPAGYVVLNNTVDASGHAGTYLNAAA
SVLQQTQSQTATDDATTQMLQNAGFQFQTTPVSSSQPTMSDYGAPPMVVTAKVPPVAQLK
RNANAATKTPISVLSKVQPHQQQQQHSQVVNKVLPTHQQQHQQTQQKQQLNNLKLQAQFQ
RQQLQTNELKNKQQQQQAAQTHVQQTGTTCGAPPSIASKPLQKKTNLIRPIHKVEVKPKV
MKPATKLPTTAAALQQQQLQPSVASQVPKVALLQQRLPAPQQQLQQQQQQLQQQIQAQQQ
LQQQQQQHQPLQSLPQQQQPLPAPQLLPVAAQQPVLSIVNTAEPQATAQFVITPAVQAQA
VQLLEQQTQQQLQQQSQQQLQQQPAELLVNGSASRLQHYASNSLPTNVVNPLQQQPLVVS
ANSGTTTVVPPPNNITINSRPTNRVLPMQQRQEPVPLDSDVVVQSPTPPKPIEEPVAAGA
STQKAVVKCYAQLEQKSPSYEIELKNNNTTLDNLVQTNVLSNLQVQQLQHEPIYNENLYE
KQAEEPLQLQDKPKSNDLMLIEATTCQQQQQQQQQQHMELVENGFQLTSNENCLLEKHGF
HVEAVAMDTEDHYANLKNGSNEPLSQADEGEDDEDDDDDFSLEMATSACNDHEMSDSEEP
AVKEKISKILDNLTNDDCADSIATATTVEAGAGYQQMVDDVLATTGAGGEVPTDDDAFAA
TAEETAAVEAAASYINEMAEAHELQLKQLQAGVVLELKKPKLDDASQQQQQPETVAANEV
PTAAAPQQPPMPMRDPKRISGPHLLYEIQSEDGFTYKSSSIAEIWEKVFEAVQVARRAHG
LTPLPEGPLADMSGVQMIGLKTNALKYLIEQLPGVEKCAKYTPKYHKRNGNVSTAAGHAA
SSAGSNAAALGAGADAQALMDYGSDQEELQENAYESARCEPYSTRSEYDMFSWLASRHRK
QPIQVFVQPSDNELVPRRGTGSNLPMAMKYRTLKETYKDYVGVFRSHIHGRGLYCTKDIE
AGEMVIEYAGELIRSTLTDKRERYYDSRGIGCYMFKIDDNLVVDATMRGNAARFINHSCE
PNCYSKVVDILGHKHIIIFALRRIVQGEELTYDYKFPFEDEKIPCSCGSKRCRKYLN
NT seq 11514 nt NT seq  +upstreamnt  +downstreamnt
atgggccgctccaagttccccgggaaaccatccaagtcgattaatcgtaagcggataagt
gtcctacaattggaggatgatgccgcatcatcggcagcgcagcagcatcagcagggcgaa
cagagtacagactccgcgtcgcgcgacaaaggcaacaattgtgataacgatgacgatgat
aatgcgtcgagtggcgcggcgaccagtggtgcaaccagtggcgctgcggccgacactgcc
ggcaatggtgcaggagcaggatcgggtggatcaggtggcggcgggggcgggggcggaagc
ggaggcggtacaacaaatggcggcaatgtaaatggtggcagtcatcataagagcgccaca
tcggaggtcaaggaatgcaaaaatcaaggcaacaatatcgagcttaacaacagcaatgct
gcctccgggcccgatgatgccgccgaggacacgaacaacgatgacgacgatgacagcagc
accaatgacaagagaacaacaacagcaacaacaacaacagcagctgctgctgtcgccctt
gtgcctcaatgcctcagtgcgttgcagcgtgcacgcaaaggaggcaataaaaaattcaaa
aacttgaatctggccagagcggaggtgatgttgccctcaacgtcgaaactcaagcaacaa
caacaattgcaacttaattgcccttcatcatcctcatcgtcaactgctgctgctgctgtt
gctgctcctacgacaacgacaacaacagcagcaactatagcgagtgcgagtgcaacgctg
gcagcgacgtcgacctcaacgtcattgtcgctgtcgatgccagcagttgctgctgcggct
gctgggggcgggggaggcgcagctgctggtctgctgacgaacccctttgccagcgccgtc
gtcgtcgagtcaaatgtggccgaggaggcaacgggcgctggcaacgaagacgctgcaatg
ttaaagccatcaatcgaaatggccaatgagacggcaacggaagcagccgtcgacgcttcc
accgccaccgctgctgttgtccccagtcccaatccaaacagtgtggcggcctcgacgatt
agtgctgccacagggacacagccgccagcgacggcgatcaagcaaaagaaaactgtcacc
ttcaagaacatactggagaccagcgatgacaagtcggtggtcaagcgtttttacaatccg
gataatcgggtgccgctcgtctccatcatgaagaaggatagcatgaatcgaccgctcaac
tattgcaggggcagcgagttcattgtgcgtccctccaaactgtccaagatactcaatact
tactccaacatcgacaagctcaactcgctgaagtttcgctcagtgcctgtggcgatggca
tcctctagctcctcatcgatacaggattccagctcaatgagcctctttggctctggccta
tcgcgcgcttttggcgcaccactggccgatgaggatgccgtctctggcggtgtcacattt
cgcaagcatgagccccagcaaaaggcatccgatgacaacgaagatgatggctcggcaagc
agcgatgacattgaggatgatgatgatatggacgaagacgacatggaggacaatgatgag
gcagtctctgagaagagcgccgaacccgctgcaagcgttaatgaaatggacgtcgacgat
aggcaactggaagtggataagtccactgtgccaccaacgcgcacgcgatcttcgcgcatc
gttaagcccaataaacggctattggagttgggcagccttagcagcaagaagaactccaat
gatgccggtgtcaaagcaaagcccaagaattactttggcctgggtggtgacttttctggc
gacacagccaccgccaccgcccccgtatcgacgtctagctcatcctcaacgtcgtttccc
aactttggcaccgctaagctcaacaacagcagctttgtgctgcgccagtcgcgcctacaa
tttccattggataagagcgtctcatttgcgggcctgcccacagtctccagtgccattgcg
ccagcaaatgttcaaatgtcatttggctcgctcaacaatgccaattcagttgtggccatg
tcctgtgtggtttgcggcacgcccgttagtaacaaggatgcgccattggcacgcaagttc
ggcgtaattgcttgtgaagtctgtcgcaagttcatctccagaatgacaaaaatatcgaaa
tcatcaacggccatgcactcgagctccagctccagctcaaatgcagcgttaaccagtcag
caagtacagtgcaagggcacagatgacaccggtggcagctgtaatatacaatcgctcaaa
agccagctgaagaacttcaagaaattgtacaaggagcgctgcacggcatgttggttgaag
aaatgcctgacagcatttcagctacccacggcgcacagaagtcgcatgagtgccatacta
ccagccaacatgcgcgatgaggctgccggcaaggatgataaaggatgccccgagctgcta
tcgccaacggctagtttgcgtttctcagcgccgactgtcgctgtatcctcttctgtgggt
ggtacgaccatcaagtggaaatccagtgcggagacaacagtgagctccattaaatcgaat
ccgttggccgagaacaatgtcacctttggcagcacaccgatactgcgcccagccatactc
gaaaagccgttgttcttgaaaatcggtaacgctgtcggcgatacgaagaaaaccaaagag
tctaaaattggtgctgctgcggagactgctgttggtcaaactgctgtggccagcagcaat
gaagcagctgcaccagctaaaatcacacgcaaggccaaacaggacaaggagaaagcgtcc
agggagcaggaaagtgaaaaattgctcagtcccagtgccaaaaaggcgattgatgcggcg
actacccaagagactcaaaaggatgaaccacaaacaacggcagcaattgcagcgccgcct
ccgtcacagactagttcaactgctgccgcaagcatcaatcaagtggaggctgccgaggtg
gtggcctcaacatccacatcaacggtgccagataacttgaagcggcaacgtatcgatttg
aagggtccgcgtgtgaagcatgtgtgccgcagtgcatccattgtgctgggtcaaccgctg
gccacttttggcgacgaggatgatgagttggcagcggttgagtctgtgcaaacagcaaca
actacaactaatgcgacaccaccagaggtgacaaacccgaagaaaccgaagtcgccattg
cctgtgcaaatgatggttaccgatgagaacgacaactgtgccacatgcaagccggtgcca
agtggagacacagccgaggcacagcctcagccagttgtaaaaggcgtgctggaatcaaag
agcaacaaatcaaataccaaccaatcagaggctaaaaaggcagcagctacagcaggagca
ggagcatccaagggcaaggtgtccacacgcaatgcgacatcatcagtgtcgtcatccgcc
aacggactagtggccagcaagaagcagcgaaatatcgaagccagcagtaatgcgggaaat
caggcgacagcggcacaaagtcgccgtgctttagccaaggaggtgaaccgattaaaggcc
ctgatatcgacagacttctgggagaactatgatccggctgaggtatgccaaacgggcttt
ggactgatcgtcacagagactgtggcacagcgtgcgctctgctttctgtgcggctcgacg
gggctggatccgctcatcttctgtgcttgctgctgtgagccctaccatcagtattgtgtg
ctggacgagtacaatctgaagcacagctcctttgacgacacactgatgaacagtctgctc
gagacgagcagcatttcggctatcacaaatacagcgctgactcagctgacgcagcgtctg
aactggctgtgtccacggtgcaccgtctgctacacgtgcaacatgtcgtccggatcgaaa
gtgaagtgtcaaaagtgccagaagaactatcacagcacatgtctgggcaccagcaaacgt
ctcctcggcgccgatcgtccgctcatctgtgtcaattgtctcaagtgcaaatcgtgcgcc
accaccaaggtgtccaagttcgttggcaatctgcccatgtgcaccgcctgctttaagttg
cgcaagaagggaaacttctgtccaatctgtcaaaagtgctacgacgacaacgattttgat
ctaaagatgatggagtgcggcgattgcaatcaatgggtgcactccaaatgcgaaggtctc
agcgatgagcaatacaatctgctcagcactctgcccgagtccattgagtttatatgcaag
aagtgtgcaagacgctgcgatgtctcacgcaacaaggcagaagagtggcgacaggccgtc
atggaggagttcaagtcgagcctgtacagtgtgctgaagctgctcagcaagtcgcggcag
gcgtgcgccctgctcaagctcagtccgcgcaagaaattgcgctgcagttgcgcggctggc
gcggccaagactcagagccagggcaagttgcagccgaaggcactgcagttcaactacaat
ggtctcgggagcgatggtgagtcacagaacagtgacgatgtctacgagttcaaggagcag
caatcgcaagccaatcccaagccaacaacgccagtgccatgcagctgcctgcagccggtg
acacaatcgcattcgtttagcctggtcgatatcaagcagaagatcgccggtaatgcgtac
gtatcactggcggaattcaactacgacatgagccaggtgatacagcagagcaactgtgat
gaactggacattgcctacaaggagctgctgagtgagcagtttccttggttccagaacgaa
acgaaggcctgcaccgatgcactcgaggaagacatgtttgagtcgtgcggctacgaggaa
ctggaggagtcaccatccacctatgcccaggagcatgcggcatctcaacctcctcgtgtt
ggcgtcctcgacataccgctggatgatgtggatgatctgggcagtggctgtgcgctgaaa
acccgtctcgattcgcgcgtctgcctcttctgccgcaagagcggcgagggtctctccagt
gaggaggcgcgtctgctctattgcggtcacgactgctgggtgcacacaaactgtgccatg
tggtccgccgaggtgttcgaggagatcgatggatcactgcagaacgtgcacagtgctgtg
gcgcgcggacgcatgattaagtgcaccgtttgtgggaatcgtggcgccacagttggctgc
aatgtcaagtcgtgcggtgagcactatcattatccctgtgcgcggagcatcgattgcgcc
ttcctcactgacaagtccatctattgtccggcacacgcacgcaatgccctcaaagcgaac
gggtcgcccagcgtcacctatgaatcgaactttgaggtgtcgcgtcccgtctacgtggaa
cttgatcgcaagcgcaagaaactgattgagccggcgaaggtgcagtttcacattggttcg
ctggaggtgcgacaattgggttcgattgtgccacgattctcggactcgtttgaggccatt
gtgccgatcaattttctgtgcagtcgcctctactggtcatcgaaggagccctggaaaatt
gtggagtacacggtgcgcaccaccatacagaatagttactccaccacactgacactggat
gctggtcgcaattttaccgtggatcacagtaatcccaattgctcgctggtgcagctgggt
ctggcgcagatagccaaatggcatggtagcttagcgcgcagcgatctcctcgagtcagat
tgggccgagtttcccaattcgtatgtgccgcccgatgagaatacggaggaagaaccgcag
cagaatgccgatctattgccgccagagattaaggatgcgatatttgaggatttgccgcat
gagctgctcgacggcatctccatgctggacatattcatgtacgaggatctggacaagact
gaattcgcgatgagcgaacagtccaaggatggcacaacacccagcttgacccaagcagcg
ggcagcgcttcagtcaccatctgtgacgaggacacacgcaattcgaatagcctgagcaaa
cagctggagctgagcaattgctggccagccagcaatccagtcgaggatgccatgctctca
gccgcgcgcagctctaatcaggccaagcagctgaagagcaaagccacagctccgacccgc
tcctgggccaaattagatggcagcagtgtggcggcccttaaacgacgcaaactctccaag
aatctgaccgagggcgtcctcctcagcctcaaccagcgtagcaaaaaggaaatggccaca
gtggccggcatcacgcgacgtcagtccgtctgcagcagtagcaatggcgaaatctcaacc
gacgccagcgctggcatgcgcaccaagagctttacgtggagtgcggcaaagcgttacttt
gagaagagcgagtcccgcgatgagcccgccaagctgaagatcatgcaaatggatggcgtg
gatgactcgattaccgagtatcgcatcattggcggcgatggcaatctgtcgacggcacag
tttacgggccaggtgaagtgtgagcgttgccagtgcacctatcgcaactatgactccttc
cagcgccatctgcccagctgtgagcccatgtccaccagtgaatccgaatcggagacaaca
actgccgccgccgctactcaacttagtgccgagagcctcaatgagctgcagaagcaggca
ctggcggccgccacattgaccaatggaggtggcctcaactatctgcagacatcgtttccc
caagtccagaatctggccacattggggcagtttggtgtgcagggactgcagggtttgcaa
gcgcttcaattgcagccgcagtccttgggcaatggtttctttctatcacatccaaatgct
gctccggccaccagcaatggcaacgacgaactgcaactatatgcgaactcactgcagagc
ttggccgccaatctgggtgggggcttcactctggcacagccgacgcaagcgcagccccag
ttaattgcgctctccacaaatccggatggaacgcaacagttcatccaattgccacaaagc
actgcgggagcgacacaattccagacggcggcgccaacgttagcaacgacgaccacatac
cagacactgcaggcgaccaacagtgataagaagattgtgttgccgttgcggggcactggg
aagccgctcaagacggtggccaccaaggcggcgcaacaggcgactgctgctgccaagcag
aagcaattaaaatccgcacatggcgtcaaacctattcaggctaaattgcagccacacccg
cagcagcagcaacatcatcatcaacagcaacaacagcaccaacaacaacaacaacacacc
ccgattacagtggcaaccaatggagccacacagctacttggccagaatctgttgcagcca
cagttgctcttccagagcaatgcccacccacaagcgcaacagctgctgttgccacagacc
caggcgcagaatatcatctcatttgtgacgggcgatggcagccagaatcagccgctgcag
tacatctcgattccaacgacaaacgactttaagccgcagcagcagacgacgacgccgacc
ttcttaacagctgcacccggcggtggtgcgacatttctgcaaacggatgccagcggcaat
cttgtgctaaccactgcaccgagcaattctggtctgcagatgctaacgggtcagctgcag
acgcagccgcaagttattggtacgctgattcagccgcagacactacagttgaccaccacg
ggtgcagatggaacgcagagcgcgacaacgcagcagccgctaattttgggtggaaatgga
gctggtggtgcaactgggctggaatttgccacagccacgccgcaagtcatattggccacg
cagcccatgtattatggattggagacaattgttcagaatacggttatgtcatcgcagcaa
ttcgtgtcgtcggccatgcccggtgtgctcagccagaatgccagcttttcggcgacgaca
acgcaagtgttccaggcaagcaaaatcgagccgattgtcgacttgcccgccggctatgtg
gtgctcaacaatacggtcgatgcgagcggacatgcgggcacctatttgaacgcggcggcc
agcgtattgcagcagactcaatcgcagacggcgacggatgatgccaccacacagatgctg
cagaatgctggctttcagtttcaaacgacgcccgtctcgtccagtcagccgaccatgtcg
gattatggggcaccaccaatggtagtcacagcaaaagttccaccggtggcgcagctgaag
cgcaatgcaaatgctgccaccaagacgcctatatcggtgctgagcaaggtgcagccgcat
cagcagcaacagcagcactctcaggtggtcaacaaggtgctgcccacacatcagcagcag
catcagcagacgcagcagaagcagcagctaaacaatctgaagttgcaagcacagttccag
cgccagcagctgcagacgaacgagctgaagaacaaacagcagcagcagcaggcagcgcaa
acgcatgtgcagcaaacgggcaccacatgtggtgcaccgccaagcattgcatcgaagccg
ctgcagaagaaaactaatcttatacggcccatacacaaggtggaggtgaaaccgaaggtc
atgaagccggcgaccaagttgccaacgacagcagcagcattgcagcagcagcaactacaa
ccatcagtggcaagtcaggtgccaaaggtggcgctgctgcaacagcgattgcctgcaccg
caacagcaactccagcagcaacaacaacaactgcaacagcaaatccaggcgcaacagcaa
ctgcaacaacaacagcagcagcatcagcctttgcagtccctgccacaacaacaacaaccg
ttgccagcgccacaattgttgccagttgctgcccagcagccagtcctcagcattgtaaat
acagccgagccacaagcaaccgctcagtttgtgataacgccagcggtacaggctcaagct
gtgcagctgttggagcagcagacgcaacaacagttgcagcaacagtcgcagcaacagttg
cagcagcagccggcggagctgctcgttaatgggagtgcaagtcgattacagcattatgcc
agcaattcgctgcctaccaatgtggtgaatccgttgcagcagcagccgctggtggttagt
gccaacagtggcaccaccactgtagtaccgcctccgaacaatataacgatcaacagtcga
cccacgaatcgggtgctgcccatgcagcagcgtcaggagccggtgccccttgacagcgat
gttgtggtgcagtcgccaacgccacccaagcccatcgaggagccggtagccgcgggggca
tccacgcagaaagctgtcgtcaaatgttatgctcaactggagcaaaagtcacccagctac
gagattgagctgaagaacaacaacacaacgctggataacctggtgcagacgaatgtatta
tctaatctgcaggtgcaacagctgcaacatgagcccatctacaacgagaatctgtatgag
aaacaggcagaggaaccgttgcagctgcaagacaaacccaaaagcaatgatctaatgctt
atcgaagccacaacgtgccaacagcaacaacaacagcagcagcagcaacatatggagcta
gtagagaatggctttcagttgacctcgaatgagaattgtctgctggagaaacatggcttc
catgtcgaagctgtggccatggataccgaggatcactatgccaatctcaagaatggcagc
aatgagccgctcagccaggccgatgaaggcgaggatgatgaggatgacgacgatgacttc
agcctcgaaatggctacatccgcatgcaacgatcacgaaatgtccgacagcgaagagccg
gccgtcaaagagaagataagcaaaattctcgacaacctaacgaacgatgattgcgctgac
tcaatagcaacagcgaccactgtcgaggccggcgccggctatcagcagatggtggacgat
gtgctggcgacaaccggagctggtggggaagtgcccacggacgatgatgcctttgcagcc
accgccgaagagaccgctgccgttgaggccgctgccagctacattaacgaaatggccgag
gcacatgagctgcaattgaagcaactgcaggcaggcgttgtactcgaactgaagaaaccc
aaattagacgacgcgtcacaacaacagcagcaaccagagacagtcgctgccaatgaggtg
ccgacagcagctgctccccagcagccgccgatgccgatgcgggacccaaagaggataagc
gggccacatttgttgtacgagatacaaagtgaggatggctttacctacaagtccagctcc
attgctgagatctgggagaaggtgttcgaggcagtgcaggtggcacgacgtgctcatggt
ctcactcccctgcccgagggccccctagccgacatgagtggcgtgcaaatgattggcctg
aagacgaacgccctcaaatacctcattgagcagctgccgggcgtggagaagtgcgccaag
tatacgcccaagtatcataagcgcaacggcaacgtctccacggcggctggccatgccgcc
agcagtgctggcagcaatgcggctgcacttggtgcaggagctgatgcgcaggcgctaatg
gattacggctcagatcaggaggagctgcaggagaacgcttatgagagcgcacgctgcgaa
ccgtatagcactcgctccgaatacgatatgtttagctggcttgcgtccaggcatcgcaag
cagcccattcaggtctttgtccagccatccgataatgaactggtgcccagacgcggaact
ggcagcaatctgcccatggcaatgaagtaccgtacgctgaaggagacctacaaggattac
gtcggagtctttcgttcccatatccatggacgcggtctctactgcaccaaagacattgaa
gcgggtgaaatggttatagagtacgctggcgagctgatacgctccacgctgacggataag
cgggagcgctattacgacagccgtggcattggctgctacatgttcaagatcgacgacaat
ctcgtggtggatgccacgatgcgtggcaatgcggctcgttttatcaatcactcctgtgag
ccgaattgctactcgaaggtcgttgatatacttggccacaagcacatcatcatctttgcc
ctgcgacgcatcgtgcagggcgaagagttaacctatgactacaagttcccattcgaggat
gagaaaattccctgttcctgcggctcgaagcgctgccgcaagtacttaaactaa

DBGET integrated database retrieval system