KEGG   Drosophila grimshawi: Dgri_GH19918Help
Entry
Dgri_GH19918      CDS       T01061                                 

Definition
GH19918 gene product from transcript GH19918-RA
Orthology
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.1.2.15]
Organism
dgr  Drosophila grimshawi
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 837 aa AA seqDB search
MAVKQNNTEQQNDGAPGGGGGAGADPATATSTSNVPGSNNNISDKGGGSNDASNGSDASP
KAGGSDSSDRQHDIKALLRIMQIINPEEQQATLVIYHHVICKLARMPMSTKPEDLKRFKE
EINKVGNYLAMPNKKSYLMFYLRIVYQLITETAYEPSCAVAIVFQLFSPDLIIEAVQSLL
DQDVQDDSIRKTVGLLCKWICFCNFCQNLNLWIMALLQGLREQEKYLLLDEIALDNIEML
FWPMILPAMRPKVAPVVFHMLSTINQAPEIFHKILPKIPPVINSLKNQSNSMDESSYLQK
MVDLTNALMMRFYDNDELYAPIKAALQMYEPSQNCVVLARALFENALPRNARVGLVNLGN
TCYMNSVLQALAMTSDFVRQILLIESGSLLLLKVQQQIALMHHSMRYELTPSRVLKATRP
PGFTPGLQQDSSEFLGYLLDLLHEHEINSGAHNLQHMDTDVVGGHQAKELKDASEPAASL
TDEIVAAGVIPYNSNDHEICAVHNSRPNAPGAISPATPTATPTNAQQKKPPSTIDKTFAG
KLSTTYKCLNCGWESRNEDSFRELQLSFPDDKDDCGAANYSVQDLIDYYCSPEKLDGDNQ
YFCPRCKKLCDAERRIGITQAPRNLILTLKQFKYDQKYHFRTKLMHKVFHDESVNVKVCS
TDSLQETCTVHYDLYAGVVHAGYSMDSGHYFTFAADQSKNWFKFNDSLVTNSKPQEMHSL
TSPNTPYILFYQMCGRSTETAPDGPMHPMVPVPLIPPLTLDELPRTLRDYVKQDNRDYNE
ELKMQRFKRNAKRNNVSSNGTMTRNGYDGDDEDDQSPPPAGGCGGPDLAMNMNRFVY
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcaagcaaaacaacaccgaacagcaaaatgatggtgcaccgggcggaggagga
ggagcaggagcggatcctgcaacagcaacatcaacgtcaaacgtgccgggcagcaacaac
aatatctcagacaaaggcggcggttccaatgatgcctccaatgggagcgatgcatcgcca
aaagcaggcggctccgattcatcggatagacagcatgatattaaggcactgctgcggatc
atgcagatcatcaatccggaggagcagcaggcgacgctggtgatctatcatcatgtcatc
tgcaagttggcgcgcatgccgatgagcaccaagcccgaggatctgaagcgtttcaaggag
gagatcaacaaggtgggcaactatctggcgatgcccaacaagaagagctatctgatgttc
tatctgcgcatcgtctaccaactgatcaccgaaaccgcctacgagccctcctgtgccgtt
gcgattgtctttcagctgttcagtccggacctgatcattgaggcggtgcagtcgctgctc
gatcaggatgtgcaggatgacagcatacgcaaaacggtgggcttgctctgcaagtggata
tgtttctgcaacttttgccagaatctcaatctgtggataatggcgctgttgcagggactg
cgcgaacaggagaaatatctgctgctcgacgagattgcattggacaacatcgagatgctg
ttctggccaatgatcttacccgcaatgcgacccaaagtggcgcctgttgtctttcacatg
ctctcaaccatcaatcaggcgccggagatattccacaagatattgccaaagataccgccg
gtgataaactctttgaagaatcaatcgaatagcatggatgaatcgtcctatttgcaaaaa
atggtcgatctgaccaatgcgctgatgatgcgcttctacgacaacgatgagctctacgcg
cccatcaaggccgccctccaaatgtacgagccgtcgcagaactgtgtcgtccttgcccgt
gccctcttcgagaatgccctgccacgcaacgcccgggtcggtctggtcaatctgggcaac
acctgctatatgaacagtgtgctccaagcactggccatgaccagcgattttgtgcgtcag
attctactgattgagagcggctcgttgctgctgctgaaggtgcagcagcagattgcgttg
atgcatcattcgatgcgttacgagctgacgccgtcgcgtgtgttgaaggcgacacgtccg
ccgggctttacgcccggactgcagcaggacagctcggagttcctaggctatttgctggat
ctgttgcatgagcatgagatcaatagcggggcgcacaatctgcagcacatggacacggat
gttgttggaggccaccaggccaaagagttgaaggatgccagcgaaccggctgcctcccta
acggatgagatagtggccgctggcgtaataccctacaatagcaacgatcatgagatctgt
gccgtgcacaattcgaggccaaatgcacccggggctatcagcccagccacgcccacagct
acgcccaccaatgcacagcagaagaagccgccgtcgaccatcgataaaacgttcgccggc
aaattgtcgacgacgtacaaatgcctgaactgcggctgggagagtcgcaacgaggatagc
ttccgggagctgcaactctcatttccggatgacaaggacgactgtggcgcagccaattac
tcggtgcaagacctaatcgattactactgctcgcccgagaaactcgacggcgacaatcag
tacttctgtccgcgctgcaagaaactctgcgatgccgagcggcgcatcgggatcacccag
gcgccccgcaatctcatcctcacgctgaagcagttcaagtacgatcagaagtaccatttt
cgcaccaagctcatgcacaaggtgttccacgatgagagcgtgaacgtcaaggtgtgctcc
acggactcactgcaggagacgtgcacggtgcactatgatctatatgcgggtgtggtgcac
gccggctacagcatggattcaggtcattatttcacgtttgccgcggatcagtcgaagaat
tggttcaaattcaatgacagtctggtgaccaactcgaagccacaggagatgcacagcctc
acctcgccgaatactccgtacatattgttctatcagatgtgcggccgatcgacagaaacg
gcgcccgatggaccaatgcatccgatggtgccggtgccgctgatcccaccactgacgctc
gacgagctgccgcgcacgttgcgcgactatgtcaagcaggataatcgcgactacaacgag
gagctgaagatgcagcggttcaagcgcaacgccaagcgcaacaatgtcagcagcaatggg
acgatgacaaggaacggctacgacggcgacgacgaggatgaccagtcgccgccgccagct
ggcggctgtggtggccccgatctggccatgaacatgaatcgttttgtctactga

DBGET integrated database retrieval system