KEGG   Drosophila grimshawi: Dgri_GH19919Help
Entry
Dgri_GH19919      CDS       T01061                                 

Definition
GH19919 gene product from transcript GH19919-RA
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
dgr  Drosophila grimshawi
Brite
Enzymes [BR:dgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     Dgri_GH19919
Protein kinases [BR:dgr01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   Dgri_GH19919
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 413 aa AA seqDB search
MRIFPVRLSAISSSMSNLAKMLDFYSGFNPSPLSIKQFMDFGQNACEKKSYIFLRKELPV
RLANIMKEIALLPDNLLHTRSVSEVSSWYVKSFEDVLEYEKIEPTHDNLQKFVHNLDLIR
NRHNDVVQTMAQGVIEMKENEGGNVDAPTESSIQYFLDRLYMSRISIRMLINQHTLLFGS
SPHSLGRHIGCLDPCCDLSDVVRDAYENARFLCDQYYLASPELEIQQYSITDEPLPINTV
YVPSHLYYMLFELFKNSMRAVVEHHTRNNCDTLPPLKVAISRGKEDICVKISDQGGGIPR
SQSDQLFKYMYSTAPQPSKSDLHTAPLAGYGYGLPISRLYARYFHGDIVLLSCEGFGTDA
IVYLKALSDEANELLPIFNKTSSKFYRATVPTGDWSNQVKYIKKPKKTSAVSQ
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatttttcccgtgcgtctctcggccatctcgtcgtccatgtcgaacctggccaaa
atgctggacttttattcaggcttcaatccgtcgccgctgtcaataaaacaatttatggac
tttggacaaaatgcatgcgagaaaaaatcgtatatatttctgcgaaaggagctgcccgtg
cgtctggcgaatatcatgaaggagatcgcattgctgcccgataatctgctgcacacgcgt
tccgtgagcgaggtgagctcctggtatgtgaagagcttcgaggatgtgctggagtacgag
aagatcgaacccactcatgacaacctgcaaaaatttgtgcacaacttggatctcattagg
aatcgtcacaatgatgttgtgcaaacgatggcccagggcgtcatcgagatgaaggagaac
gagggcggcaatgtcgatgcgccgacagagagttccatacaatattttctcgatcgcctc
tatatgtcacgtatcagcattcgtatgctaatcaatcagcatacgctgctgtttggctcg
agtccgcattcgctgggccggcacattggctgcttggatccctgctgtgatctgtcggat
gtggtgcgcgatgcgtacgagaatgctcgcttcctctgtgatcaatactatttggcgagt
cccgaactggaaatacagcagtacagcatcacggacgagccgttgcccataaacaccgtt
tatgtgccgtcgcatttgtactatatgctgtttgagctatttaagaactcgatgcgagcc
gttgttgagcatcacactcgtaacaactgtgatactttgccgccgttgaaggtggccatt
tctcggggcaaggaggatatttgtgtgaagatctccgatcagggcggcggcattccacgc
tctcagtctgatcagctgttcaagtatatgtacagcacagcaccgcagccatccaagtcg
gatctgcacacagcaccactggccggctacggctatggcctgcccatctcaaggctctat
gcacgctatttccacggcgatatcgtgctgctctcctgcgaaggcttcggcaccgatgcc
atcgtctacctgaaggcgctttcggatgaggccaacgagctgttgcccatcttcaacaag
acgagctcaaagttctatcgcgcaacagtgcctacgggtgactggtcgaatcaggtaaaa
tacatcaagaagccgaagaagacgagcgctgttagccaataa

DBGET integrated database retrieval system