KEGG   Drosophila grimshawi: Dgri_GH19931Help
Entry
Dgri_GH19931      CDS       T01061                                 

Definition
GH19931 gene product from transcript GH19931-RA
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dgr  Drosophila grimshawi
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dgri_GH19931
Enzymes [BR:dgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Dgri_GH19931
Exosome [BR:dgr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dgri_GH19931
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 524 aa AA seqDB search
MEIRHNILQLRLLLVSVLFLAIGHAQGDHQHARSSAVHSLPVKNPEEMEALYWRENAQST
LAAKLAALELAHTKKAKNVILFLGDGMSIHTVTATRNLLGDSSAKVYFEQFPYTGLSKTY
CINRQVADSACTATAYLGGVKGNYGTIGVNANVPRYDCKAAYEAANQVDGIAKWAQDVGK
DVGLVTSARVTHASPAGVYAHISDRNWENDAEVISAQCDPEESIDIARQLVEWDVGKRLK
VILGGGRQNFLNNTERDEAGYQGYRTDGRNLIKNWLADKKDQKASYVWSHKGLTQLDLDN
TDYLLGLFASGHLPYDGDRERSPKNSPLADPSLTELTEAAIRVLSRNDEGFFLFVEGARI
DMAHHDNYARRSLEDTAEFARAVQKAREMTSDQDTLIVVTSDHSHVLTVNGYPRREQDIT
GLADKDADDNLPYNILSYANGPGYAGTYTKTDGRKRVTQKHTEYPLYVSPSMVPLNADTH
GGDDVTVFASGPYAQYFSGNYEQTNIPAMMARAAGIGPYANVQP
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggaaatacggcataatattctgcaactgcgattgctgcttgtcagcgttttattcctg
gccattggccatgcgcagggagaccatcaacatgcccgatcatctgctgtccattcgctt
cctgtgaagaaccctgaggagatggaggccctctactggcgcgagaatgctcagagtacg
ctggcagccaagttggccgctctggaattggcacacacgaagaaggcgaagaatgtgata
ctctttctgggagatggcatgtccattcatactgtgacggcaacacgcaatctgctgggc
gatagctccgccaaggtctactttgagcagttcccctacacgggtctgtccaagacgtac
tgcatcaatcgccaggtggccgattccgcgtgcaccgcgacagcctatttgggcggagtg
aagggcaactacggcacaattggcgtgaatgcgaatgtgccgcgctacgattgcaaagcc
gcctatgaggcggcgaatcaggtggatggcattgccaagtgggcacaggatgtgggcaag
gatgtgggccttgtgaccagtgctcgggtgacgcatgcctcgccagctggcgtatatgcg
cacatctccgatcgcaattgggagaacgatgccgaggtgatttctgcccaatgcgatccc
gaggagagcattgacatagcacgtcagctggtcgagtgggatgtgggtaaacgtctcaag
gtcattttgggaggcggtaggcagaatttcctcaacaacacagagcgcgatgaggctgga
tatcagggctatcgcacggacggacgcaatctaatcaagaactggctggcggacaagaag
gatcagaaagccagctatgtgtggagtcacaaaggtctcacccagctcgatctggacaac
acggactatctgcttgggctgttcgccagtggacatctaccctacgatggtgatcgcgag
cgcagtcccaagaacagtcctctagccgacccctctctcaccgaactaacggaggcggca
attcgtgtcctcagtcgcaacgatgagggcttctttctgtttgtcgagggtgctcgcatc
gacatggctcaccatgacaactatgcgcgtcgctccctagaggacactgctgagttcgcc
agggctgtgcagaaggcacgcgaaatgacctccgaccaggatacgctcattgtcgtcact
tccgatcattcgcatgtgttgaccgttaacggctatccgaggcgagagcaggatataacg
gggttggcggacaaggacgccgatgacaatttgccgtataatatactctcctatgccaac
ggaccgggctatgcgggcacctataccaagacggatggtcgcaagcgggtcacccagaag
cacacggaatacccgctgtatgtgagcccctcgatggtgcccctcaacgcggacacgcat
ggtggtgacgatgtgaccgtctttgcctccggcccctatgcacagtacttcagtggcaac
tacgagcagaccaatataccagccatgatggccagggccgccggcattggaccctatgcc
aatgtccagccttag

DBGET integrated database retrieval system