KEGG   Drosophila grimshawi: Dgri_GH19963Help
Entry
Dgri_GH19963      CDS       T01061                                 

Definition
GH19963 gene product from transcript GH19963-RA
Orthology
K01641  
hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
dgr  Drosophila grimshawi
Pathway
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Module
C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Dgri_GH19963
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Dgri_GH19963
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dgri_GH19963
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Dgri_GH19963
Enzymes [BR:dgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     Dgri_GH19963
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 463 aa AA seqDB search
MSSRWPENVGIRAIEVLFPAQYVDQAELEQFDGASAGKYTIGLGQAKMGFCSDREDVNSL
CLTVVSRLLERHHIKHTEIGRLEVGTETIVDKSKSVKSVLMQLFAESGNTDIEGIDTTNA
CYGGTAALFNALNWIESSSWDGRYALAVCADIAVYAKGAARPTGGAGAIAMLVGPQAALI
FERGLRATHMEHAYDFYKPDLSSEYPTVDGKLSIQCYLSALDICYRLYRKKFEKQHPEQS
QRGLQNFDAILFHTPFCKLVQKSVGRLSFNDFLLSSEQQRLEHFAGLERFNSATLESTYF
DRDVEKAFLAQSAEVFASKTKKSLLLANQVGNMYTPSVYSGLVSLLIGGPAADLVGKRIG
VFSYGSGLAASMYSIKVTQDVTAFEKFVAKLDYVLPLLNAREKIAPEQFSALMEVRERNN
HAAPYTPTGSISALSPGTYYLKDVDALHRRSYDRTPTITNGVH
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtagatggccagaaaatgttggaatacgcgcaattgaagtgctcttccccgcg
caatatgtggaccaagcggaactggaacagttcgatggcgcatccgccggcaagtacaca
attggcctgggccaggccaaaatgggtttctgttcggatcgcgaggatgtcaactcgttg
tgcctgaccgtcgtcagtcgactactggagaggcatcacatcaagcatacggaaattggt
cgactggaagtcggcaccgaaacgattgtcgataaatcgaaatcggtgaaatcggtgctg
atgcaactgtttgcggagagtggcaacaccgacatcgaaggtatcgataccacaaatgcc
tgttatggcggcaccgccgctctcttcaacgccctcaactggatcgagtcatccagctgg
gatggccgttatgcgctcgccgtttgtgccgacatcgccgtctatgccaagggggcggcg
cgtccaacaggtggcgctggcgccatcgccatgctggtgggtccacaggcggcgctgatc
ttcgaaaggggattgcgtgccacgcacatggagcatgcctatgacttttacaagcccgat
ctgagctccgagtacccgacggtcgatggcaaactatccattcagtgctatctgtcggca
ctggacatctgctatcgcctctaccggaagaagttcgagaaacagcatccggagcagtcc
caacggggtctgcagaactttgatgccatcctgttccatacgccattctgcaaactggtc
cagaagtctgtgggtcgtttgagcttcaacgatttcctgctgagcagcgagcagcagcgt
ctcgagcactttgctggacttgagcgcttcaacagtgccacactggagagcacttacttt
gaccgggatgtggagaaggcgttcctcgcccagtccgccgaggtgtttgcttccaagacc
aagaagtcactgttgctggcaaatcaagtgggcaacatgtacacgccctcggtctattcc
ggcctcgtctcgctgctaattggtggaccagctgccgatctggtgggcaagcgcattggt
gtcttctcctatggctccggtctggctgcctccatgtattccatcaaagtcacccaggat
gtgacggccttcgagaagtttgtggccaagctggactatgtgctgccgctgctgaatgca
cgcgagaagatcgcacccgagcagttctcggccctaatggaggtgcgcgagaggaacaat
cacgcggcgccatatacaccgacgggcagcatcagtgccttgtcgccgggcacctactac
ctgaaggatgtggatgcgctgcacaggcgcagctacgatcgcacccccaccatcacgaat
ggtgtacactag

DBGET integrated database retrieval system