KEGG   Drosophila grimshawi: Dgri_GH19963Help
Entry
Dgri_GH19963      CDS       T01061                                 

Definition
(RefSeq) GH19963 gene product from transcript GH19963-RA
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
dgr  Drosophila grimshawi
Pathway
dgr00072  Synthesis and degradation of ketone bodies
dgr00280  Valine, leucine and isoleucine degradation
dgr00650  Butanoate metabolism
dgr00900  Terpenoid backbone biosynthesis
dgr01100  Metabolic pathways
Module
dgr_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Dgri_GH19963
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Dgri_GH19963
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dgri_GH19963
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Dgri_GH19963
Enzymes [BR:dgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     Dgri_GH19963
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N ACP_syn_III
Motif
Other DBs
NCBI-GeneID: 6561315
NCBI-ProteinID: XP_001987443
FlyBase: FBgn0127427
UniProt: B4J8F1
AA seq 463 aa AA seqDB search
MSSRWPENVGIRAIEVLFPAQYVDQAELEQFDGASAGKYTIGLGQAKMGFCSDREDVNSL
CLTVVSRLLERHHIKHTEIGRLEVGTETIVDKSKSVKSVLMQLFAESGNTDIEGIDTTNA
CYGGTAALFNALNWIESSSWDGRYALAVCADIAVYAKGAARPTGGAGAIAMLVGPQAALI
FERGLRATHMEHAYDFYKPDLSSEYPTVDGKLSIQCYLSALDICYRLYRKKFEKQHPEQS
QRGLQNFDAILFHTPFCKLVQKSVGRLSFNDFLLSSEQQRLEHFAGLERFNSATLESTYF
DRDVEKAFLAQSAEVFASKTKKSLLLANQVGNMYTPSVYSGLVSLLIGGPAADLVGKRIG
VFSYGSGLAASMYSIKVTQDVTAFEKFVAKLDYVLPLLNAREKIAPEQFSALMEVRERNN
HAAPYTPTGSISALSPGTYYLKDVDALHRRSYDRTPTITNGVH
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtagatggccagaaaatgttggaatacgcgcaattgaagtgctcttccccgcg
caatatgtggaccaagcggaactggaacagttcgatggcgcatccgccggcaagtacaca
attggcctgggccaggccaaaatgggtttctgttcggatcgcgaggatgtcaactcgttg
tgcctgaccgtcgtcagtcgactactggagaggcatcacatcaagcatacggaaattggt
cgactggaagtcggcaccgaaacgattgtcgataaatcgaaatcggtgaaatcggtgctg
atgcaactgtttgcggagagtggcaacaccgacatcgaaggtatcgataccacaaatgcc
tgttatggcggcaccgccgctctcttcaacgccctcaactggatcgagtcatccagctgg
gatggccgttatgcgctcgccgtttgtgccgacatcgccgtctatgccaagggggcggcg
cgtccaacaggtggcgctggcgccatcgccatgctggtgggtccacaggcggcgctgatc
ttcgaaaggggattgcgtgccacgcacatggagcatgcctatgacttttacaagcccgat
ctgagctccgagtacccgacggtcgatggcaaactatccattcagtgctatctgtcggca
ctggacatctgctatcgcctctaccggaagaagttcgagaaacagcatccggagcagtcc
caacggggtctgcagaactttgatgccatcctgttccatacgccattctgcaaactggtc
cagaagtctgtgggtcgtttgagcttcaacgatttcctgctgagcagcgagcagcagcgt
ctcgagcactttgctggacttgagcgcttcaacagtgccacactggagagcacttacttt
gaccgggatgtggagaaggcgttcctcgcccagtccgccgaggtgtttgcttccaagacc
aagaagtcactgttgctggcaaatcaagtgggcaacatgtacacgccctcggtctattcc
ggcctcgtctcgctgctaattggtggaccagctgccgatctggtgggcaagcgcattggt
gtcttctcctatggctccggtctggctgcctccatgtattccatcaaagtcacccaggat
gtgacggccttcgagaagtttgtggccaagctggactatgtgctgccgctgctgaatgca
cgcgagaagatcgcacccgagcagttctcggccctaatggaggtgcgcgagaggaacaat
cacgcggcgccatatacaccgacgggcagcatcagtgccttgtcgccgggcacctactac
ctgaaggatgtggatgcgctgcacaggcgcagctacgatcgcacccccaccatcacgaat
ggtgtacactag

DBGET integrated database retrieval system