KEGG   Drosophila grimshawi: Dgri_GH20317Help
Entry
Dgri_GH20317      CDS       T01061                                 

Definition
(RefSeq) GH20317 gene product from transcript GH20317-RA
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
dgr  Drosophila grimshawi
Pathway
dgr04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dgri_GH20317
Protein phosphatases and associated proteins [BR:dgr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Dgri_GH20317
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9 DUF1398
Motif
Other DBs
NCBI-GeneID: 6559581
NCBI-ProteinID: XP_001986824
FlyBase: FBgn0127781
UniProt: B4J4Y5
AA seq 162 aa AA seqDB search
MEMCSNFDADEIRRLGKRFRKLDLDNSGALSVDEFMSLPELQQNPLVQRVIDIFDADGNG
EVDFKEFIQGVSQFSVKGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMVGNNLKDTQ
LQQIVDKTIGFADKDEDGKISFDEFCSVVGNTDIHKKMVVDV
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgtgctcgaatttcgatgcggatgaaatacgtcggctgggcaaacgtttccgg
aaactggatctggacaattcgggtgcactgagtgtggatgagtttatgtcgctgccggaa
ttgcaacagaatccgctcgtgcagcgtgtcatcgacattttcgatgcggatggcaacggt
gaggtggacttcaaggagttcattcagggtgtctcccagttcagtgttaaaggtgataaa
ttgtcaaaattgcggttcgcatttcgcatctatgatatggacaatgatggctacatttcc
aatggcgaactgtttcaggtcttaaaaatgatggtgggcaacaatttgaaagacacgcaa
ctgcaacagattgtggacaagacaatcggtttcgcggacaaggatgaggatggcaaaata
tcattcgacgagttctgttcggttgttggcaatacggatatacacaagaagatggttgtt
gatgtttaa

DBGET integrated database retrieval system