KEGG   Drosophila grimshawi: Dgri_GH20349Help
Entry
Dgri_GH20349      CDS       T01061                                 

Definition
GH20349 gene product from transcript GH20349-RA
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
dgr  Drosophila grimshawi
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:dgr03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 237 aa AA seqDB search
MADDWEFAADSKVVVKPNAANNINKWEGEDDDEDVKESWEDEEEKKDEEKPTKTEAPAKT
KPNKVLKAKLLEQECLEKEEEAKRLANMSTEEKLAEKLRLQKIQEESDLKSALETFGLTS
IDGGLDSFNPQSNEEFKEFGATLSWKIAQYKESPHFPQFIEDLVQALCVNLSTADLKKVK
MSVEVLHSEKLKMEKVSVKNKGAAKNRGKATLRTENDDIDVYQKYGDDFTDDYDDFM
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgactgggaattcgccgcggacagcaaagttgtcgtaaaaccgaatgcagcc
aacaacataaacaagtgggagggcgaggacgatgacgaggatgttaaggagagctgggag
gatgaggaggagaagaaggatgaagagaagcccacgaaaacagaagcgccagccaaaacc
aaaccaaacaaggttctcaaagcgaaactgctggaacaagagtgcctagaaaaggaggag
gaagcgaaacgtttggccaacatgtcaacggaagagaagctggcggaaaagctgcgtctg
cagaaaatacaggaagaatctgatctgaagagcgccctcgaaacattcggcttgacgagt
atagacggtggcctcgactccttcaatccgcagagcaatgaggaattcaaggaatttggt
gccacattgagctggaagattgcacagtacaaagagagtccccactttccgcaattcatt
gaagatctggtgcaggcgctgtgcgtcaacttgagcaccgctgaccttaagaaggtcaaa
atgagcgtggaggttttgcactcagaaaagttaaaaatggaaaaggtcagtgtcaagaac
aagggagctgccaagaacaggggaaaagccacgctgcgcacagaaaacgatgatattgat
gtctaccagaagtatggagatgattttaccgacgattacgacgacttcatgtga

DBGET integrated database retrieval system