KEGG   Drosophila grimshawi: Dgri_GH20640Help
Entry
Dgri_GH20640      CDS       T01061                                 

Definition
GH20640 gene product from transcript GH20640-RA
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
dgr  Drosophila grimshawi
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dgr00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1538 aa AA seqDB search
MSKDIESHSIPIAEGVNAEHVLYRLKHGSKLGVHPDVSLLGRKIILLTNYPAEGKKFVRT
EYRILDWQSKDGKPITSENHPEVHVVDTDIYSELLLKISGTFRFYFTFADRERKADAPPD
GALYVQVEPTLNVGPVGAQKVIPLNSVRCQTVMTKLLGPLNTWEAKLRVAKESGYNVIHF
TPIQELGGSRSGYSLRDQLSVNSHFAAKKGDKVTFDDVEKMIKKCRQEWGVASICDIVLN
HTANESEWLLKHPDATYSCATCPYLRPAFLLDAALAQCGADIAAGKLEHLGVPVIIDQEC
HLEALKYHLHNAYLSAVNIHELYQCDVMGYVNEFMTQVRTREPPKNVTKHERFQEIQLIQ
DPEYRRLGSTIDFELALDIFNAFHGDCFDEEARFRKCAETLRHHLDWLNERVRAEIQGYL
SYAIDNCLAGVRYERVQHDGPHVKEISIKYAVFMTYFTHTGTEGKTLKEIEQDMYGKVGE
FLMAHNGWVMGTSDPLLDFAEQQPTRANVYLKRELIAWGDSVKLRFGKRPEDSPYLWRHM
TEYVETTARIFDGVRLDNCHSTPLHVAEYLLDAARKINPELYVVAELFTNSDATDNVFVN
RLGITSLIREALSAWDSHEQGRLVYRYGGAPVGGFYANPNRDVASSVAHALFMDLTHDNP
SAVEKRTVYDLLPSSALVAMACCATGSNRGYDELVPHHIHVVDEERPYQEWGKAVDFKTG
IVAAKRALNILHGQLAEEGFTQVYVDQMDPNVVAVTRHSPTTHQTVILVAHTAFSYPHPN
AGATNVRPLRFEGILDEIILEANLTMKSDKPFDSPAPFKKDANVLNGFKQFQLHLQEHIP
LSKSQVFETNLYQDGNNTQLNFANLRPGTVVAIRVSMHPIARKSFDRLQLVTNALRSESG
SQCEDLQAIVTKLDLNALSRALFSGDQEERDMGLGGSAYDIPNFGPLVYCGLQGFVSLLT
EISPRDDLGHPLCNNLRDGNWMMDYIADRLNNFDDLKPLSVWMKATFEPLKNVPRYLIPC
YFDAIVSGVHNVLVNQVNQLMPSFIRDGHHFTQSLALATLQFLAACRSANLPGFSLALSP
PKPPKLCVTLSAGLPHFSTGYMRCWGRDTFIALRGLLLLTGRFNEARYIIIGFASAMRHG
LIPNLLDNGTKPRFNCRDAVWWWLHSIAQYVQAAPKGSDILKDKVSRIFPYDDSEPHAPG
EFDQLLYDVMQEALQVHFQGLQYRERNAGHEIDAHMTDQGFNNHIGVHPETGFVFGGNSA
NCGTWMDKMGSSEKAGNRGRPSTPRDGSAVELIGLQYAVLRFLQGISEQKLIPYSGVQRK
GPSGAVTKWTYKGWADRIQSNFDAHFFVKETDSTKVANKKSIYKDSVGATQDWTDFQLRC
NFPIALTVAPDLCNPQCAWAALEQAKKYLLGPLGMKTLDPDDWNYRANYDNSNDSGDCTV
AHGANYHQGPEWVWPIGYYLRARLIFAKKCGYLDETIEETWVILRAHLREMQTSHWRGLP
ELTNDNGSYCNDSCRTQAWSIGTLLEVLNDLHALGADV
NT seq 4617 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggacatcgaatcgcacagcatacccattgcggagggcgtaaatgctgagcat
gttttgtaccgcttgaaacatggctccaagttgggcgtccatccggatgtctcgttgctg
ggccgtaaaatcatattgctcaccaactaccccgccgagggcaagaaatttgtgcgcacc
gaatatcgcattctcgactggcagtcaaaggatggcaagccgatcaccagcgaaaatcat
ccagaagtccatgtcgtggatacagacatctacagcgagttgctgctgaagatttcgggc
actttccgtttctacttcacatttgccgatcgtgaacgcaaagcagatgctccaccagat
ggtgcgttgtatgtgcaggtggagccgacgctgaatgtgggtcccgtgggtgcacagaag
gtaatacccttgaattcggtgcgttgtcaaacggtgatgaccaagctgctggggccactg
aacacgtgggaggccaagttgcgcgtggccaaggagtctggctacaatgtcatccacttt
acgcccatccaggagctgggtggctctcgttctggttattcgctgcgtgatcagctcagt
gtcaattcacattttgcggctaagaagggcgataaagtaaccttcgacgatgtggagaaa
atgattaaaaagtgccgccaggaatggggcgttgcctccatttgcgacattgtgctcaat
cacactgccaacgagtcggagtggctgctcaagcatccggatgcaacttattcgtgtgcc
acatgcccctatttgcgtcccgcattcttgttggatgcggcactggcgcaatgcggcgct
gatattgccgccggtaagctggagcatttgggcgtgcccgtaatcatcgatcaggaatgc
catttggaagcattaaagtaccatttgcataatgcttacctatccgcggtcaatatacac
gaactgtatcagtgcgatgtgatgggctatgtgaacgagttcatgactcaggtgcggacc
cgtgagccgcccaagaatgtgacgaagcatgagcgcttccaggagatccaactgatacag
gatccggaatatcgacgcttgggtagcaccattgattttgagctggcattggatatcttt
aatgctttccatggcgactgtttcgatgaggaggcccgcttccgcaaatgtgcggagaca
ctgcgtcaccatctcgactggctgaacgagcgtgtccgtgccgagattcagggctatctc
agctatgccatcgataattgtctggctggtgtgcgctacgagcgtgtccagcacgatgga
ccccatgtgaaagagatctccataaagtatgccgtcttcatgacatactttacccacacg
ggcaccgagggcaagacgctcaaggagatcgagcaggacatgtacggcaaggtgggcgaa
ttccttatggctcacaatggctgggtgatgggcaccagcgatcccctgctggactttgcc
gaacagcaaccgacgcgcgcaaatgtttacctgaagcgcgaactcatcgcttggggcgac
agtgtgaagttgcgctttggcaagcgaccggaggatagtccgtatttgtggcgccacatg
accgagtatgtggagacaacggctcgcattttcgatggcgttcgcctggacaactgccat
tcgacgccgctgcatgtggccgaatatctgctggatgcggcacgcaaaatcaatccggag
ctttatgttgtcgctgagctattcaccaattccgatgccacagacaatgtgttcgtcaat
cggctgggcatcacgtcactgatacgcgaagcgctctccgcctgggattcccatgagcag
ggtcgtctcgtttatcggtatggtggcgcacccgttggcggcttctatgcgaatccaaat
cgcgatgttgcctccagtgtggcgcatgctctcttcatggatttaacccacgataatcca
tcggcagtggagaaacgcaccgtctacgatctcttgccctcatcggctctggtggccatg
gcctgttgtgccacgggcagcaatcgcggctatgatgaactcgtgccgcatcacattcat
gtggtggacgaggagcgtccgtatcaggagtggggaaaggctgtcgactttaagacgggc
atcgtggccgcgaagcgcgccttgaatatactccacggccagctggcagaggaaggtttc
acccaggtgtatgtggatcaaatggatcccaatgtggtggcagtgactcgccattcaccc
accactcatcagacggtcattttggtggcacacaccgccttcagctatccacatcccaat
gcgggcgcgaccaatgtgcgtccgttgcgtttcgagggcattctggacgagatcattctg
gaggccaatttgacgatgaagagcgacaagccattcgattcgccggcaccgtttaagaag
gatgcaaatgtgctgaatggtttcaaacagttccagctgcatctgcaggagcatataccg
ctcagcaagtcgcaggtgttcgagacgaatctttatcaggatggcaacaatacgcagctc
aactttgccaatctgcgaccgggcacagtggtcgccatacgcgtttccatgcatcccatt
gcccgcaagagtttcgatcgcctgcagctggtgacgaatgctctgcgctcagagtccgga
tcacagtgtgaggatctccaagcgattgtcaccaaattggatttgaacgcgttgagccgt
gcgctcttcagcggcgatcaggaggagcgtgacatgggcctgggcggctccgcctatgat
attcccaactttggaccacttgtctattgtggcttgcagggcttcgtctcgttgctaacg
gaaatatcgccacgcgatgatttgggtcatccgttgtgcaacaatttgcgtgacggcaac
tggatgatggattacattgccgatcgtctcaacaattttgatgacttgaagccgctttcg
gtgtggatgaaggcaacctttgagccactgaagaatgtgccacgctatctcataccctgt
tattttgatgccattgtcagcggtgtgcataatgtactcgtcaaccaggtcaaccaattg
atgcccagtttcatacgcgatggccatcattttactcaatcgctggcgctggcaacgctg
cagttcctcgccgcctgccgctcggccaatctgcctggattcagtttggcgctcagtcca
ccaaagccgcccaagctgtgcgtcaccttatctgccggcttgccgcacttttccacagga
tatatgcgctgctggggacgagatacgttcatcgcattgcgtggcttgttgctgctcact
ggccgattcaatgaggcacgctatatcattattggtttcgcatcggcgatgcgtcatggc
ctgatcccaaatctgttggacaatggcaccaagccgcgcttcaactgccgcgatgctgtc
tggtggtggttgcacagcatcgcccaatacgtgcaggctgcgcccaagggcagcgatata
ctcaaggataaggtgtcgcgtatcttcccctatgacgattcggagccgcatgcaccgggc
gaattcgaccagctgctgtacgatgtgatgcaggaggcactccaggtccatttccagggt
ctgcaatatcgcgaacgcaatgctggccacgaaatcgatgcacacatgacggatcagggt
tttaacaatcatattggtgtgcatccggagacgggtttcgtctttggcggcaacagcgcc
aactgcggcacctggatggacaaaatgggctcctccgagaaggccggcaatcgtggtcgt
cccagcacgccacgtgatggttccgccgtcgagctgattggtctacaatatgccgtattg
cgtttcttgcagggcatcagtgagcaaaagctaatcccatacagtggtgtgcagcgcaag
ggtccgtctggtgcggtgaccaagtggacctacaaaggttgggccgatcgcatacagagt
aactttgatgcgcacttctttgttaaggaaacggatagcaccaaagtggccaacaagaag
agcatctacaaggacagtgtaggagccacacaggactggacagatttccagttgcgttgc
aatttccccattgcgctgacagtggcacctgatctatgtaatccgcaatgcgcctgggct
gcactggagcaggctaagaagtatctgctgggaccgctgggcatgaagacattggatccg
gatgattggaattacagggccaactatgataattccaatgattcgggtgattgcaccgtg
gctcatggcgccaactatcatcagggacccgaatgggtctggcccattggctattatttg
cgcgcccgtctcatctttgccaagaagtgcggctatctggacgagaccattgaggagacg
tgggtgatactgcgtgcccatctccgtgagatgcagacatcccattggcgtgggctgccc
gagctgaccaacgacaatggcagctattgcaacgattcctgccgcactcaggcctggagc
attggcacactcctcgaagtgttgaacgatttgcatgcgcttggcgccgatgtttaa

DBGET integrated database retrieval system