KEGG   Drosophila grimshawi: Dgri_GH20675Help
Entry
Dgri_GH20675      CDS       T01061                                 

Definition
GH20675 gene product from transcript GH20675-RA
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dgr  Drosophila grimshawi
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dgr00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 539 aa AA seqDB search
MTKLYLSLVLLSALIATTWSAAFDMKEIHDQNQLVGISNAAGARINLLDPNAMAKNKYTP
PKEKDAQFWYNLANEEIAKRLAQPQVDKRKAKNVIMFLGDGMSLTTVAAARILKGQLKGN
TGEEDELSFEKFPYTGLSKTYCSNAQVPDSACTATAYLCGVKTNIVALGVTANVNFNNCS
GSMDPANQVSSIATWAQAAGKATGIVTTTTLTHASPSGAYAHATNRFFESDTDIVTYGEG
QNDPATCMDIATQLITQAPGKNFDVMLGGGMGKFLPKSVNDMFGNPGERSDGVNLLSKWQ
SLHPEGALAYNRAQLLSVDAKRIPRLIGLFNSGVMDFHKMADAATKPTLEELTKKAIEVV
SQKDEGYFLFIEGGLIDYGNHFNVPQMGLDEVHELSKAVEAAVGMTNSDETLIVVTSDHA
HPLSISGYPGRGTNILGLNNHDTDVNGVKYATLNYAVGTNPYLDENGKRENLEDKIDDPS
FIYPSYITGTIGVHSGDDVGIFATGPQSHLFSGVMQQSTIPHLMAYASCIGKGPKLCDN
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaactgtacttaagtctggtgctgcttagcgcactcattgccacaacatggtcg
gcagccttcgacatgaaagaaattcatgaccagaaccagctggttggcatctcaaatgcg
gcaggagccagaattaacctcttggatcccaatgcaatggccaagaataagtatacgcca
cccaaggagaaggatgcacagttctggtataacttggccaacgaggagatagccaagcgt
ttggctcagccccaggtcgataagcggaaggcgaagaatgtgataatgttcctgggagat
ggtatgtcactgacaacagtggcagctgccagaatactgaagggccaactcaagggcaac
acgggcgaggaggatgagctgagcttcgagaaattcccctacacgggtctgagcaagact
tattgcagcaatgcccaagtgccggattcagcgtgtacagccacggcgtatttgtgtggc
gttaagaccaatattgttgcgttgggtgtcactgccaatgtgaactttaacaactgcagc
ggcagcatggatcccgccaatcaggtcagctccattgccacctgggcgcaggcggcgggc
aaggccacgggcattgtgacaacgactactttgacccatgccagtccatcgggtgcgtat
gcacacgccacaaatcggttctttgagagcgacacggatattgtcacctatggcgagggt
cagaatgatccggctacctgtatggatattgccacacaactgattacccaggcgccgggc
aagaattttgatgtgatgctcggcggcggaatgggcaagtttttgcccaaatccgttaat
gatatgtttggaaatccgggcgagcgttcggatggtgtgaatctgctctccaaatggcaa
tccttgcatccggagggagctctagcctacaatcgtgcccagctgctgagtgtagatgcc
aagcgtataccaagattgattggtctcttcaactctggtgtgatggacttccataaaatg
gccgatgccgccacgaagcccactttggaggagttgaccaagaaggccattgaggtggtt
agccagaaagacgagggctatttcctgtttatcgagggtggccttatcgattatggcaat
cacttcaatgtaccccaaatgggactcgatgaggtgcatgagctatccaaggctgttgag
gccgcagtcggaatgaccaattccgatgagactctgattgtggtcacctccgatcatgca
catcccctatccatttctggctatccgggtcgcggtaccaatattttgggcctcaataac
cacgacaccgatgtcaatggtgtcaaatatgccaccttgaactatgcagttggcaccaac
ccgtatctggacgagaatggcaagcgcgagaatctggaagacaaaatcgatgatccctca
ttcatctacccaagttatatcactggaacgattggcgtacattctggcgatgatgttggc
atctttgccactggaccacagagtcatctattctctggtgttatgcaacagagcacgatt
ccccatctgatggcctacgcatcctgcatcggcaaaggacccaaattatgtgacaattga

DBGET integrated database retrieval system