KEGG   Drosophila grimshawi: Dgri_GH20729Help
Entry
Dgri_GH20729      CDS       T01061                                 

Definition
GH20729 gene product from transcript GH20729-RA
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
dgr  Drosophila grimshawi
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dgri_GH20729
Enzymes [BR:dgr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Dgri_GH20729
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 337 aa AA seqDB search
MSFTRQLSEMSASELNDAIDDTNFPQAHILSRGRNNSVCSTSSTSGTSSLAERAVPPTTA
NSEDANLTGNVVDNEEQLQQQQQQQQQQQLVASTTHPRPRLILKTSTSIPENSDGTQPLT
PMTPRTSTTPGHENCTFHHDLELDHKPPTREALLPDMARSYRLLLGGLGENPDRQGLIKT
PERAAKAMLYFTKGYDQNLEDVLNGAVFDEDHDEMVVVKDIEMFSMCEHHLVPFYGKVSI
GYLPCNKILGLSKLARIVEIFSRRLQVQERLTKQIAVAVTQAVQPAGVAVVVEGVHMCMV
MRGVQKINSKTVTSTMLGVFRDDPKTREEFLNLVNSK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcacacgccaactgtccgagatgagcgccagcgagctaaatgatgccatcgat
gacaccaattttccacaggctcacatcctgtcgcgtggccgcaacaacagtgtctgctca
acaagtagcacatcgggcacctcctccctggccgagcgtgccgtgccgccaaccacagca
aacagcgaggatgccaacttaacgggcaacgttgtggataatgaggaacaactgcagcaa
caacagcagcagcaacagcagcagcaactggtggccagcacaacacatccacgtccacgt
ttgatactgaagaccagcacaagcattccggaaaatagcgatggtacacaaccgttaaca
ccaatgacaccgcgcacatcgacaacgccaggtcatgagaactgcactttccatcacgat
ctggagctggatcacaagccaccgacacgggaggcactgctacctgatatggcacgctcc
tatcgcctgctactcggcggtctcggcgagaatcccgacaggcagggcctgattaagaca
ccggagcgtgccgccaaagcgatgctctactttaccaagggctacgatcagaatctcgag
gatgtcttaaatggcgctgttttcgacgaggatcacgatgaaatggtcgttgtcaaggat
attgaaatgttctccatgtgcgaacatcatttggttcccttctacggcaaagtatcaatc
ggttatttgccatgcaataagattctgggactcagcaagctggctcgcattgtggagatc
ttctcgcgtcgtctgcaggtccaggagcgtttgaccaaacaaattgcggttgctgtgaca
caagcggtgcagccggcaggtgttgcagtcgtcgttgagggcgttcacatgtgcatggtg
atgcgaggtgtgcagaaaatcaatagcaaaacggttacatcgactatgctgggcgtattc
cgcgatgatccaaagacgcgcgaggagttcctaaatctagtcaatagcaaataa

DBGET integrated database retrieval system