KEGG   Drosophila grimshawi: Dgri_GH20755Help
Entry
Dgri_GH20755      CDS       T01061                                 

Definition
GH20755 gene product from transcript GH20755-RA
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
dgr  Drosophila grimshawi
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dgri_GH20755
Translation factors [BR:dgr03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    Dgri_GH20755
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 690 aa AA seqDB search
MAKKKSEDHSGADANDSDYNEEPNFDDPPNFVDNISDEDLLGDMLAQRPSEADGVESVVV
VDNMPKVEPSRLDKLKSVINKLFSHCGEIVNVVYPVDEEGNTKGYAFMEYKTASQAEDAV
KKLNNHRLDKNYTFAVNLFTDFQKYENIPEKWEPPTVQPFKVQSDLYNFINDPDTYDQYC
VAAETAPNCVQVGFWQNTLPEPNELETRERFTDTFVKWSPLGTYVVTFHKPGVAIWGGSS
FQKIQKFPHPGTQFVEFSPCENYLVTYGPTPTGQKIIIWDIRTGGEKRSFVGDGMSVLSM
FRWSHDDKYVARMGESSIHIYETPSFYLLDLKSIKIPGIRGFSWSPTDNVIAYWVEEQNQ
IPARVTLMKIPKKREIRNKNLFHVADCKLHWQKSGDYLCVKVDRYSKLKKDKKELDVKFL
GMFYNFEIFHMREKEIPVDSIEIRELILAFAWEPIGNKFSIIHGEQNSANVSFYEVNKGV
KPSLVKRLEKKSCTHLFWSPRGQFIVMANLTMGTFEFVDTTNDYIISASPDHFRASEVEW
DPTGRYVVTGVSSWKVKEDTGFNMYTLQGRIIKRTILKNFVQFLWRPRPPTLLSEEKQKE
IKKNLKKYYPTFEQKDRLRLTRASKELLEKRAQLRETFMEYRNKRIAEWKDQKSRRQMLR
GHVDTDNLETDEVDEEVVEFLVKEEITLLE
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaaagaaaagtgaagatcattcgggagccgatgcaaatgatagcgactacaac
gaggaaccaaatttcgacgatccacccaattttgtggacaacatcagcgatgaagattta
cttggcgatatgttggcgcaacgcccctcagaggccgatggtgtcgaaagtgtcgtcgtg
gtcgacaacatgccgaaagtggagccaagtcgtctcgacaaactgaagtcggtaatcaac
aagctgttctcgcattgcggcgagattgttaacgttgtctatcccgtcgatgaggagggc
aacacgaagggctatgcgttcatggagtataagaccgccagccaggctgaggatgcggtc
aagaagctgaataaccatcgtctggacaagaattacacctttgccgttaacttattcacg
gacttccaaaagtatgaaaatatacctgagaaatgggagccgccaactgtgcagcctttt
aaggtccagagcgatctgtacaatttcattaatgatcctgatacctacgatcagtactgc
gtggctgcggaaactgcgccaaattgtgtgcaggttggcttctggcagaatacgctgccg
gagcccaatgagctggagacccgtgaacgtttcaccgatacatttgtgaaatggtcacca
ctgggcacctatgtggttacgttccacaagccaggtgtcgccatttggggcggtagtagc
ttccagaagattcagaagtttccgcatcctggcactcaattcgttgagttttcgccctgc
gagaattatttggtcacgtatggaccaacgccaaccgggcagaagatcatcatttgggat
atacgcaccggtggcgagaagcgctcctttgtcggtgatggaatgtcagtgttgtccatg
ttccgctggtcgcacgatgacaaatatgttgcgcgtatgggtgaaagctcgattcacatc
tatgaaacaccgtcgttctatttgctggatctgaagtctatcaagatacccggaatacgt
ggattttcgtggtcgcccaccgacaacgtgattgcctattgggtggaggagcagaatcag
atacccgctcgagttacattaatgaagatacccaagaagcgggagatacgcaacaagaac
cttttccacgtggccgactgtaagctgcattggcaaaagtctggcgattatctgtgcgtc
aaggttgatcgctactccaaactgaagaaggacaaaaaggagctggacgtcaagtttctg
ggcatgttctacaattttgaaatattccacatgcgcgaaaaggaaattcccgtcgattcg
atcgagatacgcgaactgatccttgccttcgcctgggagccaattggtaataagttttcg
ataatacatggcgaacaaaattcggccaacgttagcttctatgaggtgaacaagggcgtg
aagcccagtctggtcaagcgtctggagaagaaatcctgcactcatctgttctggtcgcca
cgtggccagttcattgttatggcgaatctgaccatgggcacatttgagtttgtcgatacg
accaatgattatatcattagcgcatcccccgatcatttccgcgcctccgaggtcgaatgg
gatccgactggtcgctatgtcgtcaccggcgtctcctcgtggaaggtcaaagaggatacc
ggcttcaatatgtacacgttgcagggtcgcatcattaagcgtaccattttgaagaacttt
gtgcagttcctgtggcgtccacggccgccaacgctgctcagtgaggagaaacaaaaggag
attaagaagaaccttaagaagtactatccaacgttcgagcagaaggatcgcctacgcctg
actcgtgcctccaaggagctgctcgagaagcgcgcccagctgcgtgagaccttcatggag
taccgcaacaagcgcattgccgagtggaaggatcaaaagagccgtcgccaaatgctcaga
gggcatgtggacacggataacttggaaaccgatgaagtcgatgaggaagttgttgaattt
ttagtcaaggaagaaattaccctgctagagtaa

DBGET integrated database retrieval system