KEGG   Drosophila grimshawi: Dgri_GH21188Help
Entry
Dgri_GH21188      CDS       T01061                                 

Definition
GH21188 gene product from transcript GH21188-RA
Orthology
K02089  
cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
dgr  Drosophila grimshawi
Brite
Enzymes [BR:dgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     Dgri_GH21188
Protein kinases [BR:dgr01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   Dgri_GH21188
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 316 aa AA seqDB search
MASISQNKRQKVSETQCAEEIPNNYEELDIIGTGAYGTVYRARDNVTGCFVAIKKVRIAL
TENGVSASTLREISLLKKLNTYNHPNIVKLIEVCQFLERGNKLLILLVFEYLEQDLSDLI
EGLPKSGMSPTTVQRISRELLTGIDFLHANRIIHRDLKPQNLLVSSQGHLKIADFGLAKT
YDSEMKVTSVVVTLWYRAPEVLLAQGYNSSVDIWSAACIIFELFNGKPLFPGTSEKNQLD
RIFELTGRPTDQQWPKSISVSREHFPPRSPKRPRDFYPDLCEYSDDLLSQMLSYELHSRP
SALACLSHEYFQQEPI
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaatctcacagaacaagagacaaaaagtgagcgaaacacaatgtgcggaggag
ataccgaataactacgaggaactggatattatcggcacaggcgcctacgggacagtttat
cgggcacgcgacaatgtgaccggctgctttgtggccatcaaaaaagtgcgcattgcactc
accgaaaacggagtcagtgcgtccacactgcgcgagatttcgcttcttaagaagctcaac
acatacaatcatccgaacattgttaaactgatcgaagtatgccagtttctggaacgtggc
aacaagttgctaattttgctggtcttcgagtatttggagcaggatttatccgatctgatt
gagggtctgccaaagtcagggatgtccccaacaacagtacagcgcatttcccgtgaactg
ttaacaggcattgattttttacatgcaaatcggattattcatagagatttgaagccacag
aatttgctcgtctcgtcgcagggccatttaaagatcgccgattttgggctggcgaaaacg
tacgattccgaaatgaaagtcacctcggtggtggtcaccctgtggtacagggcgcccgaa
gtgctgctagcccagggctacaacagctccgtcgatatttggagtgcggcttgcatcatt
ttcgagctgttcaacggcaaacctttatttccaggcacctccgaaaagaatcaactggat
cgcatattcgaactcaccggtcgtcccacggatcaacagtggcccaaaagtatttctgtt
tcacgggaacattttcctccccgcagtccgaaaagaccccgtgatttttatccagatttg
tgcgaatattccgatgatttgctcagccaaatgctttcgtatgagctgcattcgcgtccc
tctgctttggcctgtttgtcgcacgagtatttccagcaagagccaatctag

DBGET integrated database retrieval system