KEGG   Drosophila grimshawi: Dgri_GH21422Help
Entry
Dgri_GH21422      CDS       T01061                                 

Definition
GH21422 gene product from transcript GH21422-RA
Orthology
K00026  
malate dehydrogenase [EC:1.1.1.37]
Organism
dgr  Drosophila grimshawi
Pathway
Citrate cycle (TCA cycle)
Cysteine and methionine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:dgr01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:dgr00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:dgr00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:dgr00630]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:dgr00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 331 aa AA seqDB search
MISMKIGQIARYSRCAKKAVKVAVVGAAGGIGQPLSLLLKMSPMISTLALHDLQDIKGVV
ADLSHICTGTRVQAFVGAKELQCALEDAAIVVVPAGLPRKPGMNRADLLTVNGDVAVEVA
KTIAFVCPKALMAFITNPINTIIPIVAQILKERNVFDPNRLFGVTTLDVVRARTFVAEAL
CIDPRTVQIPVIGGHAGITILPLLSQCLPKYTVTGAERDKLVKRIQDAGNEVVEAKAGAG
SATLSMAFAAAKFVDCLLRAINGEENVIACSYVQSKVTEAEFFATPILLGPGGIYKNLGL
PQLDEQEKKAVETLVKQLQQDIAEGAKFLCK
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgatatcgatgaagattggccagatcgcccgctacagcagatgcgctaagaaggctgtc
aaggtagccgttgtgggtgccgctggtggcattggacagccgctctcgctgctcctcaaa
atgagtccgatgatttcgacgctggcgctgcatgatttgcaggatatcaagggtgttgtc
gctgatctctcgcacatatgcactgggacccgggtgcaggcgtttgtgggcgccaaggag
ctgcagtgcgcattggaggatgctgccattgtggtcgtcccagcgggattgccacgcaaa
ccgggcatgaatcgtgccgatcttttgactgtcaatggcgatgttgccgtcgaagtggcc
aaaacaattgccttcgtctgtccgaaagctctcatggcctttatcacgaatccaatcaac
acgattatacccatcgttgcccagatactcaaggaacggaatgtcttcgatccgaaccga
ctatttggcgtcaccaccctggatgttgtacgcgcccgaacatttgttgcggaagccttg
tgcattgatccgaggactgtgcagatacccgtcattggtggacatgctggcattacaata
ttgccacttttatcccagtgtctgcccaagtatacagtgactggcgcggaacgggataag
ttggtgaaacgcattcaggatgcgggcaacgaggtggtcgaggcgaaggctggcgcggga
tctgccacactttcgatggcctttgctgctgctaaatttgttgactgcctgctgcgtgcc
atcaatggtgaggagaatgtcatcgcctgctcctatgtccagtcgaaggtgaccgaggcg
gaattctttgccacgcccattctactgggaccgggcggcatttacaagaatctgggactg
ccccagctggatgagcaggagaagaaagccgtcgaaacactcgtcaaacagctccagcag
gatatcgcagaaggcgccaagtttctatgcaaataa

DBGET integrated database retrieval system