KEGG   Drosophila grimshawi: Dgri_GH21436Help
Entry
Dgri_GH21436      CDS       T01061                                 

Definition
GH21436 gene product from transcript GH21436-RA
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
dgr  Drosophila grimshawi
Brite
Enzymes [BR:dgr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dgri_GH21436
Peptidases [BR:dgr01002]
 Cysteine Peptidases
  Family C86
   Dgri_GH21436
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 195 aa AA seqDB search
MPTSSSVYHEKQSRQLCALHALNNLFQGDQSYTKAELDDICSNLSPDVWINPHRSVLGLG
NYDINVIMTALQKRNCEAIWFDKRKDPSVINLDAIVGFILNIPTDYKFGFVTLPLQRRHW
IAVRRIGDFYYNLDSKLREPDLLGNDVEMLQFLREQLSDEGQREVFLVLEQKNGAAATAD
RWLKKEEPHNSGLGT
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgccaacctcatcatcggtttaccacgaaaagcaatcgaggcaactatgtgccttgcac
gccctcaacaatctctttcaaggtgaccaatcctacacaaaggctgaactcgatgacatt
tgcagcaatctcagtccagatgtatggataaatccacatcgctcggtgctcggattgggc
aattatgatatcaatgtcataatgacagccctgcagaagcgcaattgcgaggccatttgg
tttgacaaacgaaaagatccgtctgtcattaacttggacgccattgttggcttcatactc
aacattccaacggattacaagtttgggtttgtaacgctgccgctgcagagacgccactgg
attgcagtgcgtcgcattggcgatttctactacaacctggactccaaattacgcgaaccc
gatttgctgggcaacgatgtggaaatgctgcaatttctgcgcgagcaactctccgacgaa
ggacaacgcgaagttttccttgtgctcgaacagaaaaatggcgcagcagcaaccgctgat
cgttggctaaaaaaggaggagccgcacaactctggactgggcacataa

  All links  
No link information was found.   
DBGET integrated database retrieval system