KEGG   Drosophila grimshawi: Dgri_GH21719Help
Entry
Dgri_GH21719      CDS       T01061                                 

Definition
GH21719 gene product from transcript GH21719-RA
Orthology
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
dgr  Drosophila grimshawi
Brite
Enzymes [BR:dgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dgri_GH21719
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 2189 aa AA seqDB search
MRESAHDISMDTWKQWILEAISKIRSQKQRPSVQRICQAIGTHHKFHEDIVAEKLEKAVE
SGAVIKVYNKGLHSYKAPMAKRRIKVDKSTNLYKVVAKAVNDLGECEGSTIKNIENYIQK
FNCIDLSPNVDFKAIIKLSIKKAVDTGFLVQEGKLYKKGKSLTTPRKSVVEADVLIKGEE
TCTHCSGNSQKNLNGIPEPLSSCKQCGISLHTTCANIAGRCKSQSYVLLYMLVTKGTLWN
CQKCADCVVCKIHNRGPCLLQCFACKNHFHLTCLDTIPDKKPKHPYRCKACLNIDHPKSL
RRDTGNIKLELVGNDKIVQYSNTAQKPYNNCKRQMIKSEGFIENPSTSQHCISGVAGNNR
QKKKNAVVMNKFTTPIKQKKIYRDNIVNQLNRKRNYSDLSSSTSSSDSDDEEEDDDKNAG
CEDQDDSTSSDSCTSSSSESDSSTSSSDSSECDDDNDEEDYDTDRSTLKENIFENEKKLE
FRSSPNDNESLMDVTSDNWGFAAVAKNPVDNKYKNNFKAMSYTKKMSDIYQLSPNVEANK
PNKYATDKSDNMAAKSTLPSSRNNSILENQHLPPGVNSFDVELYQEVLQKAVIKVYNNPP
EMATEKNHSLIHCGQSPKSIEIGKWNIDTWYSSPFPQEYARLLKLFLCEFCLKYTKSRSV
LDRHQNKCIWKQPPGTEIFRQGDISVFEVDGNVNKIYCQNLCLLAKFFLDHKTLYYDVEP
FLFYILTKNDQVGCHLVGYFSKEKHCSQKYNVSCILTLPQYQRQGYGRFLIDFSYLLSRE
EGQLGTPEKPLSDLGRLSYFSYWKSVVLEYLYKYRNKKTTTFKDIAIKTGLAVSDIALAF
ELLNFIKLRKNDGDIRFQITVKIDWKKVLLHHNKRSQSKTRIVIEADCLRWSPLMSISRS
PNNNIRPISNREYLSTQLIENSDSKDILYENKIEKIIEPQLNSTIELFKDTNKDCTKTTK
STSQNIDKDASYSKKNAYNSTVESTHSTPMLNDAKRSKRPFEDLIENSDSSDSKYSKKSL
ESAEYNILTKRALRLAKRKDVIPHTNKRKHFERKNNIDNVEHNVSNPVDQPHTNKEIVDK
CSLSLGAAVPEINNRNIKKHESIDKPINIVPKLRGKKSNGKRDEEAEEAPAQPSTAEVPI
KEPDNEKPTLKTPMEVVETTENEKEKEKRLVEPAPQLPKEREISVATDHCTEQVLDAVAK
KTKKALFSDTTSFEAKNSETKIAECKIEPKPVENTLNNAESTCQVKEICEIQKEPILPAP
STVELNIKEKVISTDSSTTTEKIDTVAVPIVEKTETKVLNLNCESLNKGNEPIKEISDDQ
NLKPCVSTTPAVAVEQPAPAAVPPPSSTVVDSTKILEECAKETKVVDKPETKKTITPEKV
EPKKPDVPQEPQKPPHLLQVQVKEEDKSNVRPPPSTSLPIRDKIQLKNNDHAQLQNSLTS
QFPINQMPNYHHTSQYWQWDYYSYNLCNLDPAAQKGQKQFHKDLATTMAYTHNFTQNLYQ
SAMHAHHQMHHPKDKQKVDRKNSGKKDDLSKPVSNISAVNTARDGDGNTLNCNDYNVNNQ
SNMFDQKCGNQQKQFKITDHAQQIKSIGNPQNSVPRHTNSNQAESSNLLPTSMSREAQAA
PQKPKSEHNVNNIPLVPSHPSREEKIKVSQPILQSAPHSNLQVAGQPDVNTNNMAYNNSE
AASNAPIQQQYDCGINVQINLDSPSNIGGPINHGPENPNGHMQRQFSDCSMQNQSATTPM
HMSIQNSHMQQQNNINMNLNSESSPNLNIIGNAQQHQHQNRKLTVQPDIVASSPTAAHRA
PTPKQIRNASSSNNAQQRDAKVPAAATSTQNTHHQHPQSSVSNISKGQQDGIGGGLQFTQ
LGGQHGHQQNMQTLDYIPIPQISQNFSTNPSNYDIVGMPAVIQRGMSLNSSVHSLPNSHQ
RIEQPASACAVNNFYLQNNMPSNEIVSNAPRIPVSTTLGPPSSAANNDQSISSNSGGSTP
SLAGNLCSLSKLQQLTNCLETQPCNTSPGAQSNLTPSPHHPIPPNSMTPPPHLLMQNRNI
STPPNMLQTQVTPLQYHKYYTSNMNIPPISSTQNTNRNTRNTPSAPIQHASSAISSSSNN
RTANVHISPNLMSHYGAINSYRMSPQQSPPASAYSSGGEYPNSQIPMQMGVMNMQSQYQD
ACVLQRAAQPNSMYQTYSAYLPLNGSIRR
NT seq 6570 nt NT seq  +upstreamnt  +downstreamnt
atgagggagtcagctcatgacatcagtatggatacgtggaaacagtggatacttgaggca
atatcgaagattcgatctcaaaaacaaagaccgagcgttcaaagaatttgccaggctatt
ggcactcatcacaaatttcacgaggacatcgtcgctgaaaagttggagaaagctgttgag
tctggcgcagttataaaagtatacaataaaggattgcattcgtataaggctccaatggcg
aaaaggcgaattaaggttgataaaagtacaaacctttacaaagtggtagcgaaagccgtt
aatgatttgggcgaatgcgaagggtctaccatcaagaatatagaaaactatatacaaaag
tttaactgcattgacctatcgcctaatgttgatttcaaagctatcattaaattgtcaatt
aaaaaggcagttgatactggattcctagtacaggagggaaagctatataaaaagggtaaa
tcgttaacaacaccacgaaaatctgttgtcgaagcagatgtacttataaaaggagaagaa
acctgcacacattgctcgggcaattcacaaaagaatctaaatggcattccagaacccttg
agttcctgcaaacaatgtggcatatcattgcatacaacgtgtgcaaatatcgcaggcaga
tgcaaatcccaatcgtatgtcctactctatatgcttgttacgaagggaactctctggaat
tgtcagaaatgcgcagactgtgttgtctgcaaaatacataatcgtggtccatgtttgcta
cagtgttttgcatgcaaaaatcattttcacctgacgtgcctcgatacgataccagataaa
aagccaaagcacccatatcgatgcaaggcttgcttaaacattgatcatcccaaatcgtta
aggagagacacaggcaatatcaaattagagcttgttggaaatgataaaattgtccaatat
tcaaatacggcgcaaaagccatataacaattgtaagcgacagatgatcaaaagtgaggga
tttattgaaaatccgtcgacgtctcaacattgcattagtggtgttgccggcaataatcga
caaaagaaaaagaatgccgtcgttatgaataaatttactacgccaataaagcagaagaaa
atctatcgtgacaacattgttaatcaactaaatcgcaagcggaattattcggatttatca
tcgtcaacttcatcgagcgacagtgatgacgaagaggaagatgatgataagaatgcggga
tgcgaagatcaggatgatagtacatcatccgactcgtgtacttcttcaagctccgagtcc
gattcaagcactagctcgagcgatagctctgaatgcgatgacgataacgatgaggaggac
tatgacacagatcgaagtacattgaaagaaaatatatttgaaaacgagaagaaactcgaa
tttcgatcctcgccaaatgacaatgagagcctaatggatgttacttcggataattggggt
tttgctgccgttgcaaaaaaccctgtcgacaacaaatataaaaataatttcaaagccatg
agctatacgaaaaaaatgtcggacatttatcaactatcaccaaatgtggaagccaataaa
cccaacaaatatgcaactgataaatcggacaatatggccgcaaagtccacattgccttcg
tcgcgaaacaattccattttggaaaatcaacatttaccgccgggcgttaattcttttgac
gttgaactgtatcaagaagtactgcaaaaagctgtcattaaagtctataacaatccaccc
gaaatggcaactgagaaaaaccactcactgatccattgtggacaaagtccaaaatccatt
gaaataggaaaatggaatattgacacatggtactccagcccatttccacaggagtacgcg
aggctattaaaacttttcttatgcgaattctgcctgaagtacacgaaaagtcgatcagta
ttggatagacatcaaaataaatgtatttggaaacaaccgcctggaactgaaatatttcgg
cagggcgatatatctgttttcgaagtggatggaaatgttaataagatctattgccaaaat
ctatgcctgcttgcaaagttttttctagatcacaaaactctgtactacgatgtggaacct
tttctattttatatattaaccaaaaatgatcaagtcggatgtcatctcgttggatatttt
tcgaaagagaagcactgctctcaaaagtataatgtctcatgcattctgactctaccccaa
tatcaaagacaaggatatggccgatttttgatcgacttcagctatttgctaagtcgcgaa
gaaggccaattgggaacgccagagaagccactttcggatcttggacgtctatcatacttt
tcatactggaaatcggttgttttagagtatttgtacaagtacaggaataaaaagacgaca
acgtttaaggatattgccataaaaaccggtttggctgtttctgacattgcattagcattt
gagctactaaatttcatcaaattgagaaaaaatgatggtgacattcgattccaaatcacg
gtaaaaatcgattggaaaaaggttttattgcaccataataagcgaagtcaaagtaagact
cgaattgtaattgaagccgattgcctgagatggagtcccttgatgtcgatttccagatca
cccaataataatatacgaccaatttcaaatcgtgaatatttgagtactcagcttattgaa
aattctgatagcaaggatattttgtatgagaacaaaattgagaaaatcatcgaacctcaa
ctaaattccaccattgagcttttcaaagatacaaataaagattgcacgaagacgacaaag
tcaacttctcagaatatcgataaggatgcaagttactctaaaaagaatgcatacaatagc
actgtggaatcaacgcactcaacgccaatgctcaatgatgcaaaacgttcgaaacgtcca
tttgaagatttaattgaaaattccgattcctctgatagtaaatattcgaagaaatcgtta
gagtctgcggaatacaatattttaaccaaacgagcactgcgtctggctaagcgcaaagat
gttattccacataccaacaagaggaaacatttcgagcgtaaaaataatattgataatgtg
gagcataatgtgtcgaatccagtcgatcaaccgcacactaataaagaaatcgtagacaaa
tgttctttatcgcttggtgctgctgtaccagaaattaacaatcgcaacattaagaagcat
gagtcaattgacaagccaataaatatcgtacccaagttgagaggtaaaaaatcaaatggc
aaacgagatgaagaagctgaagaagcgcccgctcagcccagcaccgccgaagtcccaata
aaagaacctgacaatgaaaaaccgacgttgaaaacacctatggaagttgtggagacaacc
gaaaacgaaaaggaaaaggaaaaacggcttgttgagcctgcaccgcagctgccgaaggaa
agggagatcagtgttgccactgatcattgcactgagcaagtcctcgatgccgttgccaag
aagacaaagaaagcactgttttcggacacaacttcatttgaagctaaaaacagcgagact
aaaatcgcggaatgtaaaattgagccaaagccggttgaaaatactttgaataatgctgaa
tcaacatgtcaagttaaggaaatttgtgaaatacaaaaagaacctattttaccggctcct
tctacggttgaattgaatattaaagaaaaagtcattagcaccgactcatcaaccactact
gaaaagattgatacggttgcagtgccaatcgttgagaaaactgaaactaaagtacttaat
ttgaattgtgaaagcctgaataagggcaatgagcctataaaggagatctccgatgatcag
aacttgaaaccttgtgtatcaacaacgccagctgtggctgttgaacaaccagcgccagcc
gcggtgccgccaccatcatcaactgtcgttgattctaccaaaatccttgaagagtgcgcc
aaggaaaccaaagttgttgataaacctgaaactaagaaaacgattacgccggagaaagta
gagcctaaaaaaccggatgtgccccaggagccacaaaagccaccacacttacttcaagta
caagttaaggaagaagataaatccaatgtgcgtcctccgccgtccacttcattgcccata
cgggataagattcaattaaagaataacgatcatgctcagttgcagaactcgctaacttct
caattcccgattaatcaaatgcccaactatcatcatacttcgcaatattggcagtgggac
tattacagctataatctctgcaacctggatccagcagcacaaaagggtcaaaagcaattt
cacaaggacctcgcaacaaccatggcctatacgcataatttcacccaaaatctgtatcaa
tcggcaatgcatgctcatcaccagatgcatcatccgaaagataagcaaaaggtggatcgc
aagaatagcggtaagaaggatgatctgtccaagcccgtatccaatattagcgctgtcaac
actgcaagagatggcgatggaaatacgctcaactgcaatgattataatgtcaataatcag
tcgaatatgtttgatcagaagtgcggcaatcagcagaagcagttcaaaatcaccgatcat
gcacaacaaatcaagtcgattggtaatccccagaactcagtgcccaggcacacaaattct
aaccaggcggagtcatcaaatttattaccaacttcaatgagtcgcgaggctcaagcagcg
cctcaaaaaccaaaatcggagcacaatgttaacaacataccattggtgccatcccaccca
tcaagagaggaaaaaattaaggtatcgcaaccgatattacaatcggctccacactctaat
ttgcaagtcgctggacaacctgatgttaataccaataatatggcttacaataattcggag
gcagcctcaaatgcaccaatccagcagcaatatgattgtggtattaatgtgcaaatcaat
ctggattcaccctctaacattggaggtcccattaatcatggaccggaaaatcccaatgga
catatgcaaagacagttttcagactgttccatgcaaaatcaatcggcaacgacgcccatg
cacatgtccatacaaaattcgcacatgcaacagcaaaacaatataaatatgaatttgaat
tctgaaagttcgcccaatttaaatataatcggcaacgcacaacagcaccagcatcaaaac
agaaagctaaccgtacagccggatattgtggcgagttcaccgacagcagcgcatcgagca
ccgacacccaagcaaattcgcaatgcaagctcttcgaataatgctcagcagcgagacgct
aaagtgccagcagcagcaacaagcactcaaaatactcaccaccagcatccgcagagctct
gtttcgaatatttccaaggggcaacaggatggaattggcggaggcttacagtttacacag
ctcggcggtcagcatggtcatcagcagaatatgcaaacattggactacataccgataccg
caaatttcacaaaatttctccacgaatccatcgaattatgacatcgttggtatgccggcc
gtcattcaacggggcatgtctctaaatagttccgttcattccctacccaactcgcaccag
cgcattgagcagccagcctccgcgtgtgctgtaaataatttttacttgcaaaataacatg
ccatcaaatgaaatagtgtcgaacgcaccacgaataccggtctccaccacattggggcca
ccatcttccgccgctaacaatgatcagtctatatcatcgaacagtggtggcagtacacca
tctctcgctggcaatttatgtagtctatccaaactacagcagttaactaattgcctggaa
actcaaccatgcaatacatcgccaggagctcaatcgaatttaacaccgtcgccacatcat
ccgattccacccaactcaatgacaccgccaccacacttattaatgcaaaaccggaatatt
tccacgccgccgaatatgttgcagacgcaagtgacgccactacaatatcataaatattac
accagcaacatgaatattcctccaatttcatccacccaaaatacaaatcggaatactcgg
aacacaccatcagcacccattcagcatgcctcatcggcaatcagcagcagctcaaataat
cgcacagccaatgtgcacatcagtcccaatctgatgtcacattatggagctattaacagc
tatcgaatgtcgccgcagcaaagtcctccggcatctgcatatagttccggtggtgaatat
cccaactcgcaaattccaatgcaaatgggtgttatgaacatgcagtcacaatatcaagat
gcatgcgtcctgcaaagggctgcgcaaccgaattcaatgtatcaaacgtattcagcatac
ttgccgctgaacggctcaatacgcagataa

DBGET integrated database retrieval system