KEGG   Drosophila grimshawi: Dgri_GH21789Help
Entry
Dgri_GH21789      CDS       T01061                                 

Definition
GH21789 gene product from transcript GH21789-RA
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dgr  Drosophila grimshawi
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dgri_GH21789
   01230 Biosynthesis of amino acids
    Dgri_GH21789
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dgri_GH21789
   00030 Pentose phosphate pathway
    Dgri_GH21789
   00051 Fructose and mannose metabolism
    Dgri_GH21789
   00052 Galactose metabolism
    Dgri_GH21789
Enzymes [BR:dgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dgri_GH21789
Protein phosphatases and associated proteins [BR:dgr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dgri_GH21789
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 838 aa AA seqDB search
MNSENHQRFLARGSQRDKGLAVFTSGGDSQGMNAAVRACVRMAIYLGCKAYFIREGYQGM
VDGGDCIQEANWASVSSIIHRGGTIIGSARCQDFRERAGRLKAANNLVQRGITNLVVIGG
DGSLTGANLFRQEWSSLLDELAKNSTITAEQRNKYNVLHIVGLVGSIDNDFCGTDMTIGT
DTALHRIIEAIDAIASTAYSHQRTFIMEVMGRHCGYLPVVAGIISEADYVFLPEHPPPQD
WPDRLILQLQQASKRSRLMSVSSDFYLAISAAIATEADFMLIPEEPVELLWQDRLCKKLE
QERSAGQRLNIVIVAEGAMDREGHPITAEDVRKVIDERLKHDARITVLGHVQRGGNPSAF
DRVLACRMGAEATLALMEATSESLPVVISLDGNQTVRVPLMECVERTQAVAKAMKERRWA
DAVKLRGRSFERNLETYKMLTRLKPPKECFDENGKPIEGYRLAVMHIGAPACGMNAAVRS
FVRNAIYRGDVVYGVNDGIEGLIAGNVRELGWSDVSGWVGQGGAFLGTKRTLPEGKFKEI
AARLKEFRIQGLLIIGGFESYHAAGQISDQRDNYPEFCIPIVVVPSTISNNVPGTEFSLG
CDTGLNEITEICDRIRQSAQGTKRRVFVIETMGGYCGYLATLAGLAGGADAAYIYEEKFS
IKDLQQDVYHMASKMAEGVSRGLILRNEKASENYTTDFIYRLYSEEGKGLFTCRMNILGH
MQQGGSPTPFDRNMGTKMAAKCVDWLATQIKNNIDANGVVNCKSNDTATLLGIVSRQYRF
SPLVDLIGETNFDQRIPKKQWWLRLRPLLRILAKHDSAYEEEGMYITVEEECDTDAVA
NT seq 2517 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtgagaatcatcaacgtttccttgcgcgcggctcgcagcgcgacaagggtttg
gccgtcttcaccagcggcggcgattcccagggcatgaatgcggctgtgcgagcctgtgtc
cgtatggccatctatttgggatgcaaggcgtatttcatccgggaaggctaccagggcatg
gtcgatggcggtgattgcattcaggaggcaaactgggcatctgtatcctcgatcatacat
cgtggtggcaccatcattggctccgcccgttgccaggacttccgtgagcgcgctggtcgc
ttgaaggccgccaacaatttggtgcagcgtggtattaccaatctggtggtaattggcggc
gatggttccctaactggcgccaatctgttccgtcaggagtggtccagccttctggatgag
ctggcaaagaattcaaccattaccgccgagcagaggaacaagtacaatgtgctccacatt
gttggattggtgggttcgattgataacgatttctgtggcacggacatgacaattggtacc
gacaccgcattgcatcggattattgaggcaatcgatgcgattgccagcacggcctactca
catcagcgtaccttcatcatggaggtcatgggtcgtcattgtggttatttacctgttgta
gctggcattatatccgaggcagattatgtctttctgccagagcatccgcctccacaagat
tggcccgatagactcatactccaactgcaacaggcaagcaagcgatccagattaatgagt
gtctcatccgacttctacttagcaatttcagcggctattgccacagaggctgattttatg
ctaattcccgaagagcccgttgaacttctatggcaggacagactatgcaaaaaactagag
caggagcgttcggctggtcagcgtctgaacattgtcattgttgcggagggtgccatggat
cgcgagggacatccgattactgccgaggatgtgaggaaggtgatcgatgagcgtctgaag
cacgacgctcgcatcactgtcctgggtcatgtgcaacgcggtggcaatcccagcgccttt
gatcgtgtcttggcttgtcgcatgggcgccgaggcgaccctggccctaatggaggcaaca
tcggaatcgctgcctgttgtcatttcactggatggcaaccagacggtgcgtgtgccactg
atggagtgcgttgaacgcacccaggccgtggccaaggccatgaaggagcgtcgctgggcg
gatgccgttaagctgcgtggtcgttccttcgaacgcaatctggaaacgtacaagatgttg
acgcgcttgaagccgcccaaggaatgcttcgatgagaatggcaaaccgatcgaaggctac
aggctggctgtgatgcacattggtgcgcccgcttgcggcatgaatgcggcggtgcgcagc
tttgtccgcaatgccatctatcgcggcgatgttgtctatggcgtcaacgatggcatcgag
ggtctcattgctggcaatgttcgcgagctgggctggtcggatgtgtctggctgggttgga
caaggtggtgcatttttgggcaccaagcgcactctgcccgagggcaagttcaaggagatc
gctgctcgcctcaaggagttcaggatccagggtctgttgatcatcggtggattcgagagc
taccatgccgctggccaaatctccgatcagcgtgacaattatccagagttttgcataccg
atcgttgtcgttccatcgaccatctcgaataatgtgcccggcactgagttctcgctgggc
tgcgacactggcctcaacgagatcaccgaaatctgcgatcgcattcgccaatcggctcag
ggcaccaagcgtcgcgtcttcgtcattgagacaatgggtggctattgcggttatttggcc
acgctggccggcttggctggcggcgcggatgctgcctacatttacgaggagaagttctcc
attaaggacctgcaacaggatgtctaccacatggcctcgaagatggccgagggcgtttca
cgcggtctcattttgcgcaatgagaaggccagtgagaattacaccactgacttcatctat
cgcctgtattcggaggagggcaagggtctcttcacttgccgcatgaatatcctgggacac
atgcaacagggtggctcacccacacccttcgatcgcaacatgggcaccaaaatggccgcc
aagtgtgtcgactggctggcaacccagatcaagaacaacatcgatgccaacggtgtggtc
aattgcaaatcaaacgatacggcaacactgctcggcatagtttcgcgtcagtatcgcttc
agcccactggtggatctcatcggcgagaccaactttgatcaacgcataccgaagaaacag
tggtggctgcgtttgcgtcccttgttgagaatcctggccaagcacgattccgcctatgag
gaggagggcatgtacataaccgtcgaggaggaatgcgacacagatgccgtcgcttag

DBGET integrated database retrieval system