KEGG   Drosophila grimshawi: Dgri_GH21911Help
Entry
Dgri_GH21911      CDS       T01061                                 

Definition
GH21911 gene product from transcript GH21911-RA
Orthology
K15719  
protein O-GlcNAcase / histone acetyltransferase [EC:3.2.1.169 2.3.1.48]
Organism
dgr  Drosophila grimshawi
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1012 aa AA seqDB search
MGEKCTTLEHASQDQQRNFICGVIEGFYGRPWTTEQRKDLFRKLKKMGMDSYMYAPKDDY
KHRAYWRELYTVEEADHLSSLISSAKEAGIVFYYALSPGLDMTYSSQKEIATLKRKLDQV
SQFGCEAYALLFDDIESELSKADKEVFQTFANAHVSVTNEIFTHLGCPKFLFCPTQYCGT
RAVPTVVDSEYLNTLGSKLNNVIDILWTGDKVISKTITIDSIREITEILRRPPVIWDNLH
ANDYDQKRVFLGPYSGRSPELIPHLRGVMTNPNCEFYGNFIAVHTLAFWSRCNLDSKMNS
SLSADIKLETENEDDLPAECLSKNVYHPRLALKNAISEWLPEFFVEKEAWGPITKPQPQV
EMVMPIIPIIPSLNTCMSLTTTTTTSTNTRTVPEVNTTQLQALADVCSTVSSTMAPISNP
VMNSLVSPTKVVTNDDIINPIRTTVASNIELPKKIPISIMPVPVMETKSVEETIKLSCEI
FEPANKAEPLNEPSKSDLTPTSDDILIDGKREQVANLNVDTMLDENLSLSPLSGAGINEP
MECSSINSQISPKEAVKLVTDDVVMEESGNDANSMHVESSSASPESTAEMHDEVDDDQLG
AKSTASCNKITLDDLNLLCDLFYLPFEHGSRGLKLLSEFQWLKVNANVLLQDHSSGSSSD
ASKSIKPEVSEWMQRSEIFSELCGCVQKLLVKIAYCENKEICHNLYSYVWDISGALSLLN
CYIKWLSMAKFPQNTSSFTEGSYTWFSKGWKEAFMSGEQEPWVFRGGLTADLQRLMPVDS
ANDLFVYKLPEQPTANYYLLRPYQHQDEQQINAICTRTYMQWQSEPDGDEILLPAQFADI
VSDAMVGGHLTLHPELCLVAYDKSNSIVGYACAALDINLFKRNMELCWLTELREKYPKTL
LDDTAKSHKLVSSFVERFHMHVDEVVCPTEVYGTFPAVISAATLREAEQHDNGIAKRLLT
VLLAALRACGCFGVHACVPQEDREQVNFYTKVGFVDIYRDEGSKCIYLGRRF
NT seq 3039 nt NT seq  +upstreamnt  +downstreamnt
atgggggaaaaatgtacaactttggagcatgcaagccaagatcagcaacgtaattttatt
tgcggcgttattgagggcttctacggccggccttggacaaccgagcagcgaaaagatttg
tttcgcaaactgaaaaaaatgggcatggactcgtatatgtatgcgcctaaagatgactac
aagcaccgggcatactggcgcgagctctatacagtcgaagaggccgatcatctatcaagt
ctgatttcatctgctaaggaggctggcattgttttctactatgctctttcgccgggtctg
gatatgacgtacagcagccagaaggagattgcaacgctgaaacgtaaactggatcaagtg
tcacagtttggctgcgaggcatatgcgctgctcttcgacgacatcgaatcggagttgtcc
aaggccgacaaggaagtgttccagaccttcgccaatgcgcatgtctcggtaaccaatgag
attttcactcacttgggctgtcccaagttcctcttctgcccgacgcagtattgcggcaca
cgtgccgtcccaactgtcgtggattcggagtacttgaacacactgggctccaagctgaac
aatgtgattgatattctctggacgggcgacaaagtcatctcgaagacgataaccattgac
tcaataagggaaatcacggagatactgcgtcgtccgcctgtcatttgggataatctgcat
gcgaatgattacgatcagaagcgtgtattccttggaccgtattcgggtcgatcgccggag
ctgataccccatctgcgtggtgttatgaccaatccgaactgtgagttctatggcaatttc
attgctgtgcacacgctcgccttctggtcacgctgcaacctggactcgaagatgaacagc
tcgctgagcgccgatatcaaactggagactgaaaacgaagacgatctgcccgcagaatgt
ctgtccaagaacgtctatcatccacgtctagctctcaaaaatgcaatttctgagtggctg
ccggagttctttgtggagaaggaggcgtggggaccgattacaaagccgcagccgcaagtt
gaaatggttatgccgattattccgataataccgtcgctcaacacgtgcatgagtcttacg
acgacgacaacaacgtcgacgaatacgcgcacggtgcccgaggtgaacaccacccagttg
caggcactggccgatgtgtgcagcacagttagctctacaatggcgccaatttccaatcca
gtgatgaactctttggtttcaccgacgaaagttgtgacaaacgatgacattataaatccc
atacgcacaactgttgcatccaatattgagttgccaaagaagatacccatttccataatg
ccagtgcccgtcatggagaccaagagcgttgaggaaaccattaagctgagctgcgagata
ttcgaaccggccaacaaggcggagcctctcaatgaaccctccaaaagcgatctcacgccc
acatccgatgacattctcattgatgggaagcgcgagcaggtggcgaatttaaatgtcgac
acgatgttggatgaaaacttgagtctcagtccattgagtggtgccggcatcaatgagccc
atggagtgcagcagcattaactctcagatttcgcccaaggaggccgtcaaactggttacc
gacgatgttgttatggaggaatcgggaaacgatgcgaatagtatgcatgtggaaagttca
tcagcgtcaccggaatccactgcggaaatgcacgacgaagtcgatgatgaccaattgggc
gccaaatccactgcaagctgcaataagataactttggatgatttgaacctgctttgtgat
ttattctatttaccctttgagcatggcagtcgtggcctgaaactactcagcgagtttcaa
tggctgaaagtcaatgcgaatgtgctgctccaggatcacagcagtggcagtagcagcgac
gctagcaagtccattaagccagaagtgagtgagtggatgcagcgcagcgaaattttctcc
gagctttgtggctgcgtgcagaagttgctggtgaagatcgcctactgcgagaacaaggag
atatgccacaacttgtattcgtatgtgtgggacatatcgggtgcactgtcgctgctcaat
tgctacatcaagtggctgtcgatggcaaaatttccgcagaatacatcctcattcactgag
ggcagctacacgtggtttagcaaaggctggaaagaggctttcatgtccggcgagcaggaa
ccatgggtgtttcgcggtggcctcactgcagatttgcagcgcctgatgcctgttgactcg
gccaatgatttgttcgtttacaagttgcccgaacagccgaccgcaaactattatctactg
aggccatatcagcatcaggatgagcaacaaataaacgcaatctgcacacgcacctacatg
caatggcagagtgaaccggatggcgatgaaatcctactgcccgcccaattcgctgacatt
gtgtcggacgctatggttggtggtcacttgactctgcatccggaactctgtttggtggcc
tatgacaagagtaactcgattgttggctatgcctgcgccgctttggatattaatttgttt
aagcgcaatatggaattatgctggctaactgagctgcgcgagaaatatcccaagactctg
ctggatgacaccgcaaagtcgcacaagcttgtctcaagttttgtggagcgtttccacatg
catgtcgacgaggtcgtctgccccaccgaggtctacggcacctttccggctgtgataagc
gccgcaacgttgcgggaggcggaacagcatgataatggcatagccaagcgactcctgacc
gtattgcttgccgcattacgcgcctgtggctgtttcggggtgcacgcctgcgtgccacaa
gaagatcgggagcaagtgaatttctacacaaaggttggcttcgttgacatctatcgcgat
gagggcagtaagtgcatttatttgggtcgacgcttctag

DBGET integrated database retrieval system