KEGG   Drosophila grimshawi: Dgri_GH21921Help
Entry
Dgri_GH21921      CDS       T01061                                 

Definition
(RefSeq) GH21921 gene product from transcript GH21921-RA
  KO
K01189  alpha-galactosidase [EC:3.2.1.22]
Organism
dgr  Drosophila grimshawi
Pathway
dgr00052  Galactose metabolism
dgr00561  Glycerolipid metabolism
dgr00600  Sphingolipid metabolism
dgr00603  Glycosphingolipid biosynthesis - globo and isoglobo series
dgr04142  Lysosome
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Dgri_GH21921
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dgri_GH21921
   00600 Sphingolipid metabolism
    Dgri_GH21921
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    Dgri_GH21921
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dgri_GH21921
Enzymes [BR:dgr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Dgri_GH21921
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Melibiase_2 Melibiase_2_C Melibiase
Motif
Other DBs
NCBI-GeneID: 6561314
NCBI-ProteinID: XP_001987442
FlyBase: FBgn0129382
UniProt: B4J8F0
AA seq 411 aa AA seqDB search
MLYALVPLLLLLHEGLALDNGLALTPPMGWMSWQRFRCITDCDTYPDECISEQLFSRHAD
LLVSEGYAAAGYEYVIIDDCWLEKERDQKTNKLVPDRNRFPRGLNVLADHIHNKGLKFGL
YQDYGTNTCAGYPGVINHMELDAQTFANWDVDYVKLDGCYANVSDMALGYPEFGRLLNST
GRPMVYSCSWPAYQSELNELPDFESLKKHCNLWRNWDDIDDSLESVMQIMDYFGKNQESM
QQHGGPGHWNDPDMLILGNYGLSYDQSKLQMAIWAVLAAPLIMSNDLAYVRPEIKEILQN
RDVIAVNQDPLGIQGRRLLLKNDIEVWRRPITPQTDGNEYSYAVAFVSRRTDGAPYSIKF
TLKELSLKNKNGYAVKDLFDSNTNLGVFQSESYFSTRVIPNGVNFYKFTAL
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgttgtatgctctggttccactgctactgctgctccacgaaggattggccctcgacaat
ggcctggcactaacaccaccaatgggctggatgtcctggcaacgtttccggtgcataacc
gattgcgacacttatccggatgagtgcataagcgagcagttattctctcgtcatgcggat
ttgctggtttcggagggttatgctgctgctggctacgagtacgttattattgatgattgc
tggctggaaaaggaacgcgatcagaagacaaataaattggttccggatcgcaaccgtttt
cctcgtgggctaaatgtgctcgctgaccatatacacaacaagggtctcaagtttggcttg
taccaggactatggcacaaatacgtgtgccggctatccgggcgtgatcaatcacatggaa
ctcgacgcgcaaacctttgccaattgggatgtggactatgtgaagctggacggctgctat
gcgaatgtcagcgacatggccttgggttatccagaatttggacgactgcttaattcgacg
ggcagaccaatggtttactcctgtagctggcctgcctatcaatcggaactgaacgagttg
cccgactttgaatcgttgaagaagcactgcaatctgtggcgcaactgggatgatattgat
gattccctggaatcggtaatgcagatcatggattactttggcaaaaatcaggagagcatg
cagcaacatggtggccccgggcattggaacgatcccgatatgctcatcctgggcaattac
ggactcagctacgatcaaagcaaactacaaatggccatttgggcggtgcttgcagcgcca
ctaatcatgtccaatgatttggcctatgtgcgaccagaaatcaaggagatcctacaaaat
cgggatgtcattgctgtcaaccaggatccgctgggcattcaaggcagacgtttgctctta
aagaacgacattgaggtctggcgacgaccgatcacgccgcagaccgatggtaatgaatac
tcctacgccgtggcttttgtcagtcgccggacggacggtgctccctatagcatcaagttt
acactcaaagaattatcgctgaaaaataagaatggctacgccgtaaaggatttgttcgat
tcgaataccaatttgggtgtctttcaatcggagagttattttagtacacgtgtcattccc
aacggcgtcaatttctacaagtttacagcgctgtga

DBGET integrated database retrieval system