KEGG   Drosophila grimshawi: Dgri_GH22092Help
Entry
Dgri_GH22092      CDS       T01061                                 

Definition
GH22092 gene product from transcript GH22092-RA
Orthology
K04437  
filamin
Organism
dgr  Drosophila grimshawi
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1631 aa AA seqDB search
MDVKDIKGAKVTHAGLLKHNTDGTTETQKITHAGLVARSPEGTAAKGMNIRGNEDLWVEI
QANTFRNWVNEHLRETGMQVHDWATDFCDGTCLCALVENLQTRPLKPSWNRRPANQHHYL
ENATTALKSIEADHIKLVNIGNVDIVNGNVKLILGLIWSLIVRYQIGRSKFPPRKLMLAW
LQAALPDCKITNLTTDWNSGVNLAALLDYCQPGLFPHWRSLDPSQSVRNCTNAMNLAQRE
FNVPKVLEPEYLASPWLDELSGMTYLSYFMKPGGPGYNATMRWVNTQVKDQVKNFTSDWN
DGRVLCEIIKGLGGSAPAPDKLSTDPFHYENNIRKAVDAGAKLGVQPILTPKDMANPEVE
HLGIMAYAANLQWVTPRPPLSDSVNVYLESTSGRVGEPTHFRIDVLSRDISLSSVRCHVV
PPSGQPGHPVRLNAHGEGVYVPERYGMHEIVVEIGEDSLGGHFFRVLPRLMQVAPPGMAP
CALGSLVEVLVNATGAPKTEDILVTAVSPTGISHNCPLKKIDEGHSAIFKPDEAGIWEIA
ITYQGRHIQGGPFTCAVFDASGVSVHGLDGAMPLRAHTFEVDARGVGVNGELHVDIVHDK
HSLVCSVEKIVENKYRVTFMPRQNGKYRVYIYFNGYDVKGSPFIMRVGTKGRSGKTRSSP
LHESKHRSESPSMHFISTTNARHNDYRNASLSRRDLHSHNTAERTSSYSPQYSPKLDTTD
YHSSSSRYYKRESEENHGSPTPPLTTATTGGSPTVKYLNSADLYTETGGARRDSKTSNSS
STKNDYYYDKENELYSQRRVISKPTLAPPREERDLTATSNTQSSSSTSYQRHQQHQQLTH
SLSPIPSPTLNTRSSEMHSHSPLTIKTSNQYETSTRNISNSPRHASASPVQRYSPNNAYI
STATHRIGSPVTSTLNKNGFESTRVEKSSTYKSTSNYVTDSNVRASPSLYGTTERMRRIG
SPEPRIDHSSNVRVSSMKPASARRDSWDVINKTKHMLSHNSLESLANMTETQLNTELNYT
RPDLDNETQRNTQYNKFALHKQQQQQQQQQHQSDYRRDSPDDGERYIPSAITVKSHSNNT
YTDRSGGYTKTVKESSEHVVTESNGHSPSIANNNSGTGYGYSSLSRFRPIDSNATGARAI
RVQNIPNGSIGRPVEFEIDGSKAGSGNLEILVNGGRVTSSVRSLGGQRFIASFTPHEHGT
HTVQITFNGETVPGSPWHAEIMSSPGLTALGESTRLVPANTPAVFEILPPPGQSLSKGEC
VATVLTPNKSKLNARVTHEAANGAARIEFVPTEVGTHIIDASINGTKIAGGPLIAKVYDA
SLIQVTEVNGGVVGQPCQFRVDASAAGEGQLEISINEGEVPNHVQVVGGGRCLVSFTPEQ
AKSHLIDIKFNGETVRGCPFVCAVADTSRVLLNLTNLELIPVNRPSSFHITVSGGGAAEL
AVSVRGPQGELPVRVTGDIHAGFTAEFTPSNVGSHSINVEYNGFAVQGTPFMAKSYDASK
VVVGSVSRGTMGRPVQFTVDAGDAGEGNLEITISAKGQNIPTQVHPQGSARFSVSFVPTE
SCEHTINVSFNKMPVPGCPITVSISGGVAGPQVSLGGPGPVHQTNSFVINHNGGRLEDIE
VNVEGRRNLLY
NT seq 4896 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcaaagatatcaagggcgccaaggtgacgcacgcgggtctgctcaagcacaac
acagatggcaccaccgagacacaaaagatcacccatgccggattggtggcacgcagtccg
gagggcaccgccgccaagggcatgaatatacgcggcaatgaggatctctgggtcgagatc
caggcgaacacatttcgcaattgggtcaacgagcatttgcgcgagacgggcatgcaggtg
cacgactgggcaaccgacttttgcgatggcacctgtctgtgtgccttggtcgagaatttg
cagacgcgtccgttgaagccatcctggaatcgtcggccggcgaatcagcatcattatctg
gagaatgcgacgaccgccctaaagtccatcgaggcggatcacattaaactggtgaacatt
ggcaatgtcgacattgtcaatggcaatgtgaaactaattctgggcctgatctggtccctg
attgtgcgctaccagattggacgcagcaagttcccgccgcgtaagctgatgttggcctgg
ctgcaagccgctttgccggactgcaagatcaccaatctgaccacggattggaatagcggc
gttaatctagccgcactccttgactactgccagccgggtctgtttccgcattggcgcagt
ctcgatcctagtcagagtgtgcgcaactgcaccaatgccatgaatctggcgcaacgcgaa
ttcaatgtgcccaaggtgctcgagccggagtatctggcctcgccctggttggacgaactc
tctggcatgacgtatctatcgtacttcatgaagccaggtggacccggctacaatgccaca
atgcgctgggtcaacacgcaggtcaaggaccaagtgaagaactttacgagcgactggaac
gatggacgcgtgctgtgcgaaatcattaagggactgggcggctcggccccggcgcccgat
aagttgagcaccgatccattccactatgagaacaatatacgcaaggctgtcgatgctggc
gccaagctgggcgtgcagcccatattgacacccaaggatatggccaatccggaagtggag
catctgggcatcatggcgtatgcggcgaatttgcagtgggtgacgccacggcctccactc
tccgactcggttaacgtctatctggagagcacttccggccgtgttggcgaaccgacgcat
ttccgcatcgatgtgttgtcgcgagacatcagcttgagctcggtgcgctgtcacgtggtg
ccaccatccggtcaacccgggcatccggtgcggctgaatgcgcatggcgagggtgtctac
gtgccagagcgctatggcatgcacgagattgtcgtcgaaattggcgaggatagccttgga
gggcacttcttccgtgtgctgccgcgtcttatgcaggtggcgccacctggaatggcacca
tgcgccctgggcagcctggtcgaggtgctggtgaatgcaacgggtgcaccgaagacagag
gatattctggtcacggctgtgtcgcccactggcatctcgcacaattgcccgctgaagaag
attgacgagggacacagtgccatattcaagccggatgaggcgggcatctgggagatagcc
atcacgtaccagggacgtcacatccaaggcggacccttcacctgtgccgtgttcgatgcc
tccggcgtctctgtccatgggctcgatggcgccatgccgctgcgtgcccacaccttcgag
gtggatgcacgcggcgtcggtgtcaacggggagctgcatgtggacattgtccatgacaag
cactcgctggtctgctccgtcgagaagatcgtagagaacaagtatcgagtgacctttatg
ccgcgccagaatggtaaatatcgggtctacatctacttcaatggctatgatgtcaaggga
tcgccatttatcatgcgtgtgggcaccaagggacgttcgggtaagacgcgcagcagtccg
ttgcatgaaagcaagcatcgctcggagagtccgtcgatgcacttcatctctacaacgaat
gcgaggcacaatgattatcgcaatgcatcgctctctcgtcgggatctgcacagtcataat
acggcagagcgtacgagcagctattcaccgcagtattcacccaagctggacacaaccgat
tatcacagctccagctccaggtactacaagcgggagagtgaggagaaccacggctccccc
acacctcccctgacaacagcaacaactggcggttcacccacggttaaatatctaaactcc
gccgatctatatacggaaaccggtggcgctcgtcgcgactccaagacctcgaacagcagc
tcgaccaagaacgattactactacgacaaggagaatgagctctatagtcagcgtcgcgtc
atcagcaagcccacgttggcaccgcctcgcgaggagcgcgacctgacagccacaagcaac
acgcagagcagcagcagcaccagctaccagcggcatcagcagcaccagcagctgacgcac
tcgctcagtccaatacctagtcccacactgaatacgcgctccagcgagatgcattcgcac
agtccgctgaccatcaagacatccaatcagtatgagacctccacgcgcaacatatccaat
agtccgcgtcacgcctccgcctccccggtgcagcgttattcaccaaacaatgcctatatc
agcacagccacccatcgcataggaagtccggtgaccagcaccttgaacaagaacggcttc
gagtcgacacgcgtggagaaatcatcgacgtacaagtccacgtcaaactatgtgaccgac
tcgaatgtgcgtgcgagtccttccctgtatgggacaacggagcgaatgcgtcgcattggt
tccccggagccgcgcatcgatcactcgtcgaatgtacgggtttcctcaatgaagccggcg
tcggcacgtcgtgatagctgggatgttatcaataagacgaagcatatgctctcgcacaat
tcgctcgaatcgctggcgaacatgaccgagacgcagctgaacacggagctcaactacaca
cgccctgatctggacaatgaaacacagcgcaatacacagtacaacaagtttgcgttgcac
aaacaacaacaacaacagcaacaacagcaacatcagtcggattatagacgggactccccc
gacgatggggagcgctacatacccagtgccattaccgtcaaatcacactcgaataataca
tacacggacagatctggcgggtatacgaagacagttaaggagtccagcgagcatgtcgtc
acggagagcaatggccatagtccgagcattgccaacaataattccggcaccggttacgga
tatagctcactctcccgatttcgtcccatagacagcaatgcaacaggtgctcgagccata
cgcgtacagaatataccgaatggttcgattggacgacccgttgagtttgagatcgacggc
tccaaggccggctccggcaatctggaaatacttgtgaatggcggccgggtcacttcgtcg
gtacgctcgctgggtggccaacgatttatagccagcttcacgccccacgaacatggaaca
cataccgtgcagatcactttcaatggagagacggtcccaggttcaccgtggcacgctgag
atcatgtcgtcacccggactaaccgctctgggcgaatccacacgcctcgtacccgccaat
acaccggcggtttttgagatactgccgcctcctggacaaagcctgagtaaaggcgagtgc
gtggcaacggttttgacacccaacaagtcaaagctgaatgccagagtcacccatgaggcg
gcaaatggtgctgcacgcattgagttcgtgcccaccgaagtgggcacgcacatcattgat
gcgtccatcaatggcacaaagatcgctggcggtcctttgatagcaaaggtttatgatgcc
agcctgatccaagtgaccgaggtaaacggcggcgttgttggtcaaccctgccagtttcgt
gtggacgccagtgcagcgggtgagggacagctggagatatccatcaatgagggcgaggtg
cccaatcatgtccaggtcgttggcggcggccgctgtctcgtctccttcacacccgagcag
gccaaatcccatttgattgacatcaaatttaatggcgaaacggttcgcggctgtcccttc
gtctgcgccgtggcggacacctcgcgcgtcctgctcaacctaaccaatctggagctgata
cccgtcaaccggccctcctcctttcacatcacggtgagcggtggtggtgccgccgaactg
gcggtcagcgtccgtggtccccaaggcgaactgcccgtccgcgtcactggcgacatccat
gccggcttcacggccgagtttacgcccagcaacgttggcagtcactccatcaacgtggag
tacaatggctttgcggtgcagggcacaccatttatggccaaatcgtacgatgccagcaaa
gtggtcgttggcagcgtctcccgtggcacaatgggtcgccccgtgcagttcacggtggat
gcgggcgatgccggcgagggcaatctagagataaccatatcggcaaagggtcagaatata
cccacgcaggtgcatccccagggcagtgcaagattctccgtatcgtttgtgccgacggag
tcgtgcgagcacacaattaatgtgtcatttaataaaatgcccgtgcccggctgcccgatc
acagtcagcattagtgggggcgtggcagggccgcaggtgtcccttggtggacccgggccg
gtgcatcagaccaattcttttgttatcaatcacaatggcggccgtttggaagacattgag
gtcaacgtggaaggacggcgaaatcttttgtactag

DBGET integrated database retrieval system