KEGG   Drosophila grimshawi: Dgri_GH22093Help
Entry
Dgri_GH22093      CDS       T01061                                 

Definition
GH22093 gene product from transcript GH22093-RA
Orthology
K04437  
filamin
Organism
dgr  Drosophila grimshawi
Brite
Exosome [BR:dgr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dgri_GH22093
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1357 aa AA seqDB search
MCTMQIGGTSGPAGQSVPAQVHQSAEGVFKAEFVPRVVGEHRVNVTVNGLPTAGSPYAAK
VYDVSAIKVKNVSSGTVGKPVTFLVETSQAGPGNLEVTVNGGRVPTSAQAQGQHTYAISF
TPREAESHTVELRFNSQDVPGSPFTCRVAAAARIQSPETMDKVSVGRLFEFIVESDTKPS
VEVLGPARRSVPVKIDALGSTLGYNIKFEPMEVGDHSVEVRLPGGGHVEGSPFLLKAYSA
EKVIVTDIRPGVVNKSVSFGINASQAGAGNLEIIVAVNGKNVPNFVQSEGNARFKVNFKP
TEAAAHSLSVRFNGHPVPGSPFSCHIAAAAASSLGLPRALAMGECLKQAAVKLDNTFELE
GFDGIEPQIFVTSPSGDNEHCQLSQHDGGSYSASFRPSTVGRHLITVLANDQHINGSPFS
CNVFDVSRVSISGLEQQYGPATLGVPVTFSVDAAGAGEGTLELVVSTDSSTVKAEVVACA
RGLYDVTFVPQSTEPHYVNITFNEVAVDGSPFRVDIQQHTQHIQIGSLAAIDFPADDQIV
EILGPDQKSVPYTINRQTAEFRTHVTGNYTLRFIDRETRQHIGTRTLCAFDPMLVKITEV
GEALCHRPASISISLNEAGQGDLSALVRCGVTEVPHTIRGPSKSGVYEIVYQPTRVAPHK
ISILFNDVPISLKPLEINVLPASAGKEISVSGLGLYQARVGKTTSFAIDTVKRPAREFDV
VVSGPGGQALPVRCYQTKNGHLQAEFSINKPGQCVIEVLHQSKPLPGSPFTCEAFDSSKV
SVQGVTKEPLALHSSNSFSVRTDNAGTAELEAFAISPTNQSLPVLISEQSEGIYNVEFVP
SQPGNYKLTLMYGGETIPSSPLNFSASSSGVRNDARAAGHGLEVCHRNKEASFVVYCPIA
PNVQIERVDEFGERIEPKIKALGNNEWRISYVILSVGTYEIRASCPNRGSLPGSPWRVCC
VESTKVTPVGGWGTLVDHDGRLILPARIIFDVENAGPGKLVCSIDGIEIPVDKLADGKMC
LNITGDNLAAGEHDLDLTWSGLTITQCPRSAFVTGQQAADKVVLMGRGLAAAQAGEAAHF
TIDASNAPAGRPEVILITQDNTALPVSLAQPRPSENIWLASYTPQKSMTGTLTLSVKWNG
RLVKGCPLTVAVGSSMDASKVIASGEGLRHGIVGKDIKSWIDTRRAGPGELTAHCAGARK
VAYCELYDHGDATFTLNIKPQEPGRHLLTIKYGGQNVPGSPFALKVAGAPDASKVRVYGP
GIEHGVLATFQSRFICDTRGAGAGQLTVRVRGPKGAFRVEMQRESQKDRTILCKYDPTEP
GDYRVEVKWAGEFVPGSPFPVMIFDTEEELRRYLQGI
NT seq 4074 nt NT seq  +upstreamnt  +downstreamnt
atgtgcactatgcaaattgggggcacttcaggtcccgctggccaatcagtgcccgcccag
gtccatcagtccgctgagggcgtcttcaaggcggaatttgtaccccgcgtcgtcggcgag
catcgggtcaatgtaactgtaaacggtttgccaacagccggcagcccttatgcggccaag
gtctatgatgttagcgccatcaaggtgaagaatgtaagcagcggaacggtgggcaagccc
gtcactttcctggtggagacttcccaagcaggtcccggcaatttggaagtgacggtgaat
ggcggtcgagtgccaacgtcggcacaggctcagggtcaacacacgtatgccattagtttc
acacctcgcgaggcggagagtcacacggtggagttgcgttttaatagccaggatgtgcct
ggctcaccattcacgtgccgggttgcggctgctgctcgcatacagtctccagagacaatg
gacaaggttagcgtgggtcgcctctttgagttcattgtggaatcggacacaaagccatct
gttgaggtgctcggtccggccagacgcagtgtgccagtgaaaatcgatgcactcggctcc
acgctgggctacaatattaagtttgagcccatggaagtgggtgatcattcggtggaggtg
cgtcttcctggtggtggccacgtggagggaagtcccttcctgctgaaggcctactctgcg
gagaaggtgattgtgacggacatacgaccgggcgtggtcaataaaagcgtcagcttcggc
atcaatgcctcccaggcgggtgccggcaatctggagatcattgtcgccgtcaatggcaaa
aatgtgcctaattttgtccaatccgagggcaatgcccgcttcaaagtgaacttcaaaccc
accgaggcggctgctcactcgctctcggtgcgcttcaatggacacccagtgcccggatca
cctttcagttgccacattgcagctgctgccgccagctcgttgggattgccacgtgccctg
gccatgggcgagtgcctgaagcaggcagccgttaagctggacaataccttcgagctggag
ggcttcgatggtattgagccgcagatatttgtcacatcgccctccggcgacaacgagcac
tgtcagctgagccagcacgacggcggaagctatagcgcctccttccgtcccagcacagtg
ggtcgtcatctgatcaccgtgctggccaacgatcagcacatcaatggttcaccctttagt
tgcaatgtgtttgatgtctctcgcgttagcattagtggattggagcagcaatatggaccc
gccacgcttggtgtgcctgttacgtttagtgtagatgcagcgggtgctggtgagggtacc
ctcgagttggtcgtctccacggacagcagcactgttaaggcggaggtggtggcctgtgct
cgtggcctctacgatgtgacctttgtgcctcagagtacggagccccattatgtgaatata
acgttcaatgaggttgctgtagatggtagtccgttccgtgtggacattcaacagcacaca
cagcacattcaaattggcagcttggcagccattgattttccagctgatgatcagatcgtg
gagatactcggtccggatcaaaagtctgttccgtacacgattaacagacagacagcggag
ttccgcactcacgtgactggaaattatacgctgcgttttattgatcgcgagacaagacag
catattgggacacgcacactgtgcgctttcgatcccatgctggtcaagatcaccgaggtg
ggcgaggccttgtgccatcgaccggccagcatcagcatctcgctcaacgaagccggacag
ggtgatctgtcggcgctggtgcgttgcggagtcaccgaagtgccgcataccattcgcgga
cccagcaaatccggtgtctatgaaattgtctatcagccgacacgcgttgcaccacacaag
ataagcatactattcaatgatgtgcccatatcgctgaaaccgctcgagatcaatgtgctg
cccgccagtgccggtaaagagatcagcgtcagtggcttggggctgtatcaggcacgcgtg
ggcaagacgacctcttttgccatcgacaccgtcaagcggccagcgagggagtttgacgta
gtcgtttccggacccgggggacaggcgcttcccgtgcgctgctatcagaccaagaatggg
cacctgcaggcggagtttagcatcaacaagccaggacaatgtgttatcgaggtgctgcac
cagtcgaaaccgctgccgggcagccccttcacatgcgaggccttcgacagcagcaaggtt
agcgtgcagggcgtcaccaaggagccactggcgctacacagctccaatagcttcagcgtg
cgcacggacaacgccggcaccgctgagctggaagcatttgccatttcgccaacaaatcaa
agtttgcccgtgctcatcagcgagcagtccgagggcatctacaatgtggagtttgtgcct
tcccagccgggcaactacaagctgacgctgatgtacggtggcgagacaatacccagctct
ccgctcaactttagcgcctcgtcgagcggtgtgcgaaatgatgcacgcgccgccggacac
ggattggaggtgtgtcatcgcaacaaggaggcttcctttgttgtctactgcccaattgcg
cccaatgtgcagattgagcgtgtcgatgagtttggcgaacgcatcgagccgaagatcaag
gcactgggcaacaacgagtggcgcatttcgtatgtcatcctatctgtgggcacctatgag
attcgcgccagttgccccaatcgtggcagtctgcccggctcaccttggcgcgtctgttgc
gtcgagtccacaaaggtcactcctgtgggtggttggggcacgctggtggatcacgatggc
cggctgatactgccagcgcgcattatcttcgatgtggagaacgccggacccggcaagctt
gtctgcagcatcgatggcatcgagatacccgtcgataagctggccgatggaaaaatgtgc
ctcaatatcaccggtgataatttggcagccggtgagcatgacctggacttgacctggagc
gggctgaccatcactcagtgcccgcgtagcgcatttgtcaccggccagcaggctgccgat
aaggttgtgctaatgggtcgtggtctggctgccgcccaagctggcgaggcagcgcacttc
accatcgatgcttcgaatgcaccagctggtagaccagaggtcattctgattacacaagac
aacacagcattgcccgtgagcctggcccagccgcgtcccagcgagaacatttggctggcc
tcgtatacgccacagaaatccatgacgggcaccttgacactgtcggtcaagtggaacgga
cgcctcgttaagggctgcccgctcacagtcgccgttggctcctccatggatgcctccaag
gtgattgcgtccggcgagggtctgcgccacggcatcgttggcaaagacatcaaatcctgg
atagacacacgacgtgctggccccggcgaactaactgcccactgtgctggtgcccgcaaa
gtggcctactgcgagctgtatgaccacggtgatgccaccttcacgctaaacattaagccc
caggagccgggtcgtcatctgctcaccatcaaatacggtggacagaatgtgcccggctca
ccatttgcgctgaaggtagccggcgcaccggacgctagtaaggttcgtgtctatggtccc
ggaatagagcacggagttctggcgaccttccaatcacgcttcatatgcgacacacgtggc
gccggcgctgggcagctgacagtgcgagtgcgcggaccaaagggcgctttccgcgtggag
atgcagcgggagagccaaaaggatcgcaccattctatgcaagtacgaccctacggagccg
ggtgattatcgtgttgaggtcaagtgggctggcgaatttgtgcctggctcaccgttcccc
gtcatgatcttcgacactgaggaggagttacgaaggtacttgcagggcatatga

  All links  
No link information was found.   
DBGET integrated database retrieval system