KEGG   Drosophila grimshawi: Dgri_GH22304Help
Entry
Dgri_GH22304      CDS       T01061                                 

Definition
GH22304 gene product from transcript GH22304-RA
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
dgr  Drosophila grimshawi
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 432 aa AA seqDB search
MGANVSQLEREIGSEMFPPNEHYFGLVNFGNTCYSNSVLQALYFCKPFREKVLEYKAKNK
RPKETLLSCLADLFYSIATQKKKVGSIAPKKFITRLRKEKEEFDNYMQQDAHEFLNFLIN
HINEIILAERNNTGNTGKTTNGNTVAAAPAAASIGTSTTAKSSTNSNSNSNSSNSTTTST
SNSTTTNGNCNSNSTGSLSGAATTSVLDGGLTATTTPVVQANGANTEPTWVHEIFQGILT
SETRCLNCETVSSKDENFFDLQVDVDQNTSITHCLRCFSNTETLCSDNKFKCDNCCSYQE
AQKRMRVKKLPMILALHLKRFKYMEQFNRHIKVSHRVVFPLELRLFNTSDDAVNPDRLYD
LTAVVIHCGSGPNRGHYISIVKSHGLWLLFDDDMVDKIEASTIEDFYGLTSDIHKSSETG
YILFYQSRDCAA
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcaaatgtctcccaactggagcgggagatcggctcggaaatgtttccgcccaac
gagcattactttgggcttgtcaattttgggaatacctgctatagcaactctgtgctacag
gccctctatttctgtaagccctttcgcgagaaggtcctcgaatacaaggcgaaaaataag
cggcccaaagagacattgctttcgtgcctggcggatctcttctatagcattgcgacgcaa
aagaagaaagttggctcgattgcgcccaagaagtttataacgcgtttgcgcaaagaaaag
gaggagtttgacaactatatgcaacaggatgcgcacgaatttctcaatttcctgatcaat
cacatcaacgagatcattctggccgaacgcaacaatacgggtaatacgggcaagacgact
aatgggaataccgttgctgccgctcctgctgctgcatcgatcggcaccagcactaccgca
aagtcatcgaccaactccaattcaaactcgaactcctctaattcgacaacgacctcgact
tcgaattcgacaacaaccaatggcaattgcaacagcaattcgacgggttcattgagtggt
gctgccaccacaagtgtactggatggtggccttacggcaaccactaccccggtagtgcag
gcaaatggcgccaatacggagccgacgtgggtgcatgagatctttcagggtatactcaca
tcggagacacgttgcctcaactgtgagacggtcagcagcaaggatgagaactttttcgat
ctacaggtggacgtcgatcagaatacatcgataacgcactgtttgcgctgtttcagcaat
accgagaccctctgctcggacaacaagttcaagtgcgacaactgttgcagctaccaggag
gcacagaaacgcatgcgtgtcaagaagctaccaatgatactggcgctgcacttgaagcgt
ttcaagtatatggaacaattcaatcgtcacatcaaggtctcgcatcgggtcgtctttccg
cttgagttgcggctctttaacacctcggacgatgccgtcaatccggatcggctatatgat
ctaacggctgtcgttattcattgcggttcgggtccgaatcgtggccattacatcagcatt
gtgaagagtcacggactctggctactgttcgacgatgacatggtcgataagattgaggcc
tcaaccattgaggatttttatggcctcacctccgatatacacaaatcctcggagaccggt
tacattctattctatcaatcgcgtgactgcgctgcataa

DBGET integrated database retrieval system