KEGG   Drosophila grimshawi: Dgri_GH22637Help
Entry
Dgri_GH22637      CDS       T01061                                 

Definition
(RefSeq) GH22637 gene product from transcript GH22637-RA
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
dgr  Drosophila grimshawi
Brite
Enzymes [BR:dgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     Dgri_GH22637
Peptidases [BR:dgr01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   Dgri_GH22637
Exosome [BR:dgr04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   Dgri_GH22637
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
AA seq 424 aa AA seqDB search
MYEFHNCLKLVFYAIIIPGTILISWLTGLIGLPFLVIALLLFLVIFVLLPLAFRFSVTLQ
RSILFLTFITYPKGLDLTQPASIGLYATRNFYITVKDHNADEDGVRIGVWHVLPKNAVRR
FKRELHVEEAYEQEEQQAGQLQREQSKSTVEQANSNNNNKQLEQVAPALRNEFPVILPEN
EQIFYERLLRIPGGTVVLYLHGNTATRGSGHRSEVYKLLRHLNYHVFSFDYRGYADSDPV
APTEDGVVRDALMVFEYIANLTTNPIYIWGHSLGTGVATHMCANLAALKGRAPRGVILES
PFTNIRDEIRLHPFSRPFRRLPWFDFTISEPMYSNRLRFESDKHIDEFPQPIMIVHSEDD
VVVPFHLGYRLYRIALNKRSHAWGPVEFHRFERRHGYGHKYLCRAPEMPGLVQHFVESYR
DAIY
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgtacgagtttcacaattgtttgaaattagttttctatgcaataatcattcccggaacg
atcctcattagttggctgacggggctaattggactgccctttctggtgatagcgctgttg
ttgttcctcgtcatctttgtgctgctcccattggcctttcgcttctccgtgacgttacag
cgcagcatactctttctcacattcatcacctatccgaagggattggatctcacgcaacca
gcgagcattggactctatgccacacgcaacttttacatcaccgtcaaggatcataatgcg
gacgaggatggtgtgaggattggcgtatggcatgtgctgcccaagaatgccgtgcgtcgc
ttcaaacgcgaacttcacgtagaggaggcctacgagcaggaggagcagcaggctggacag
ttgcagcgggagcagtccaagtcaacagttgagcaagcaaacagcaacaacaacaacaag
cagctggagcaggtggcgcctgctctgcgtaacgagttccccgtaattctgcccgagaac
gagcagatcttctacgagcgtctcttgcgcattcccggcggcaccgtcgttctctatctg
cacgggaatacggcgacacggggcagtggacatcgctctgaggtctacaaactgttgcga
catctcaactatcatgtcttttctttcgactatcgaggctatgcggactcggatccggtg
gcgccgacggaagatggcgttgtgcgcgatgctctgatggtctttgagtacattgccaat
ctgacaacgaatcccatctacatttgggggcactcactgggcactggcgtggcgacgcac
atgtgcgccaacctggcggctctcaaggggcgtgcgccacgtggcgtcatcctcgagagt
ccgttcaccaatattcgggatgagattcggctgcatcccttttcgcgtccctttcgccgt
ttgccctggttcgatttcaccatctcggagccgatgtacagcaatcggttgcgctttgaa
tcggacaagcatatcgacgagtttccgcagcccattatgattgtccactcggaggatgat
gttgtggtcccctttcacttgggctatcgactctatcgcattgcgctgaacaagcgtagt
catgcctggggcccagtggaatttcatcgctttgaacggagacacggttacgggcacaag
tatttgtgccgtgcaccggagatgcccggattggtgcaacattttgtggagagctaccgc
gatgcgatctattag

DBGET integrated database retrieval system