KEGG   Drosophila grimshawi: Dgri_GH22868Help
Entry
Dgri_GH22868      CDS       T01061                                 

Definition
GH22868 gene product from transcript GH22868-RA
Orthology
K01312  
trypsin [EC:3.4.21.4]
Organism
dgr  Drosophila grimshawi
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    Dgri_GH22868
Enzymes [BR:dgr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     Dgri_GH22868
Peptidases [BR:dgr01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   Dgri_GH22868
Exosome [BR:dgr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dgri_GH22868
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 268 aa AA seqDB search
MAHANLLLLGVSLSLVIVALAHPLQDDSPNGRIVGGYATDVIHFPYQISLRRKAITAPKN
PYTHYCGGSIINENYILTAAHCVIANVASQFKVVAGTSHRNAIDGVIVTVSEIIMHEKYD
PSTYDNDIALLVLGSPLPLNNFTMKVIELGTEAPKDGDMSTISGWGTTQPGGDASDQLLA
VDVPIVGNEQCDEDYGGGSITPGMLCAGLRGEGGKDACQGDSGGPLTCGGKLHGVVSWGR
SCALPTHPGVYANVAHYIDWIHAKMGNI
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggcacacgcgaatctgttgctgctcggagtgagcttgagccttgtgatcgttgccctg
gcacatcctctgcaggacgactcccccaatggacgcattgtgggaggctatgcgacagat
gtgatacattttccatatcagatatcgctccgtcgcaaggcaatcacagcacccaagaat
ccctatactcattactgtggcggatccatcattaatgagaattacattttgacggcggcg
cattgtgttattgccaatgtggcaagtcaatttaaggttgttgccggcaccagtcatcgc
aacgccatcgatggcgtcattgttaccgtctccgaaatcataatgcacgagaaatacgat
ccatcaacatatgacaatgatattgccctgctcgtcttgggttcgccgttgccattgaat
aactttacaatgaaggtcattgagctgggcaccgaggcccccaaggatggagacatgagc
accatatccggctggggtacaacccaaccgggaggcgatgcatcagaccagttgcttgca
gtcgatgtgcccattgtgggcaatgagcagtgtgacgaggattatgggggcggttcaatt
acacctggcatgctctgtgccggtctgcgtggtgagggtggcaaggatgcctgtcagggt
gattcgggtggacccctaacctgtggtggtaagctccatggcgtcgtctcctggggcaga
tcgtgtgctctacccacacatcccggcgtctatgccaatgtcgcgcattacatcgactgg
atccacgccaagatgggcaacatctag

DBGET integrated database retrieval system