KEGG   Drosophila grimshawi: Dgri_GH22908Help
Entry
Dgri_GH22908      CDS       T01061                                 

Definition
GH22908 gene product from transcript GH22908-RA
Orthology
K04430  
mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
dgr  Drosophila grimshawi
Module
MAPK (JNK) signaling
Brite
Enzymes [BR:dgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Dgri_GH22908
Protein kinases [BR:dgr01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   Dgri_GH22908
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 433 aa AA seqDB search
MAERPKNLFATGPSRSRVPPDQLTLNNLSIRHPPSSTSSTSSGSTSSGSSSSSQQNNVAL
RFGAQNSFVPAVPMPSSSSSSHNNSTSNSSVASLGSSATDRHRERIRQQACGKLQFGEGA
INTHQFTSDDLEDLGEIGRGAFGAVNKMIFKKLDKVMAVKRIRSTVDEKEQKQLLMDLEV
VMKSNECVYIVQFYGALFKEGDCWICMELMDTSLDKFYKYIFEKKQRHIPESILAKITVA
TVNALNYLKEELKIIHRDVKPSNILLHRRGDIKLCDFGISGQLVDSIAKTKDAGCRPYMA
PERIDPERAKGYDVRSDVWSLGITLMEVATGNFPYRKWDSVFEQLCQVVQGDPPRLHTSY
NGMEFSIEFAEFVNTCLIKKESDRPKYSLLLQMPFIRRGENSHTDVAAYVADVLESMESD
GITQFTTNQPAES
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggctgagagacccaaaaatttgtttgcgactggaccgagtcggtctcgtgtgccacct
gatcagctcacgctgaacaatctgagcattcgacatccgccatcgtccacgtcgtcaacg
tcatcgggctccacatcgtccggctcgagttcctcatcgcagcaaaataatgtcgcgtta
cgttttggcgcccagaacagttttgtgcccgctgttcccatgcctagcagcagcagcagc
agccacaacaacagcaccagcaacagcagcgtcgccagcctcggcagcagtgcaacggat
cgtcatcgggagcgaatcaggcagcaggcatgtggtaaattgcaatttggtgagggtgcc
atcaatacgcatcagtttacgtcggatgatctggaggatttgggtgagattggacggggt
gcatttggtgctgtgaataaaatgatattcaagaaactggacaaagtgatggctgtgaag
cgtatacgctccacggtcgatgagaaggagcagaaacaattgctgatggatctcgaggtg
gtgatgaagtcgaatgaatgcgtttacattgtgcaattctatggggcactgttcaaggag
ggcgactgctggatatgcatggagctaatggacacatcgctggacaagttctacaagtat
atattcgagaagaagcaacggcatatacccgaatccatattggcgaagattacggtggcc
acggtaaatgcgcttaactatttgaaggaggagctcaagatcatccatcgcgatgtgaag
ccgagcaacattctgttgcatagacgcggcgatattaaactgtgtgattttggcatctct
ggccaattggttgattcaatagccaagacaaaggatgccggctgtaggccctatatggcg
ccggaacgcattgatccggaacgggccaagggctacgatgtgcgcagcgatgtttggtct
ttgggtataaccctaatggaggtcgccactggcaactttccctatcgcaaatgggactcg
gtctttgagcagctctgccaggtggtgcaaggtgatccgccacgcttgcacacttcctac
aatggcatggagttctccattgagtttgctgaatttgtcaacacttgcctgattaagaag
gagagcgatcggcccaagtatagcctattgctgcagatgccatttataaggagaggcgag
aatagccacaccgatgtcgccgcctatgtggccgatgtgctcgagtccatggagagcgat
ggcattacgcaattcacaactaaccagccagcggagagttaa

DBGET integrated database retrieval system