KEGG   Drosophila grimshawi: Dgri_GH22997Help
Entry
Dgri_GH22997      CDS       T01061                                 

Definition
GH22997 gene product from transcript GH22997-RA
Orthology
K08588  
ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
dgr  Drosophila grimshawi
Brite
Enzymes [BR:dgr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dgri_GH22997
Peptidases [BR:dgr01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   Dgri_GH22997
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 462 aa AA seqDB search
MSVAGGSISTAAGNAGKNNALPMAQLADGWLELESDPGLFTLLLEDFGCHDVQVEEVYDL
QKPIESPYGFIFLFRWIEERRARRKIVETTAEIFVKDEEAISSIFFAQQVVPNSCATHAL
LSVLLNCNENNLQLGETLGRLKAHTKGMSPENKGLAIGNTPELACAHNSHAMPQARRRLE
RTGAGVASCRFTGEAFHFVSFVPINGQLFELDGLKPYPMNHGCWEEHEDWTDKFRRVMAE
RLGIATGEQDIRFNLMAVVPDRRIAITHKLKMLRTNQAIVSGTLQKLLKADEQGERDEQQ
RPDTPTTLLEPSAFTARDLQSLLKNLDTEIAINEQHLADENDRRQMFKVDASRRTHNYDK
FICTFLSMLAHQGVLGELVSQHLLPSKKIANRLNRQTNAATAAANAANTNVAGTNAAGSK
SQQQQQQTQQQPQQTQTAKNGKSPGKTPGRRRKGRNKCRKRK
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcgcaggcggctctattagcaccgctgcaggcaacgccggcaagaacaatgca
ctaccaatggcacagctcgcagatggctggctggagctagaatctgatccaggtcttttc
acactgctcctggaagattttggctgtcacgacgtgcaggttgaagaggtctatgatctg
caaaagcccattgagagtccctatggatttattttcctgtttcgctggatcgaagagcga
cgggcgcgtcgcaaaatagtggagacaactgccgagatatttgtcaaggatgaggaggcc
atctcaagcatattctttgcccagcaggtggtgccgaatagctgtgccacccatgcgctg
ctctctgtgctgctcaactgcaacgagaataatctgcagctgggcgagacgctgggtcgc
ctcaaggcccacaccaaaggcatgagtcccgaaaacaagggtctcgccattggcaacacg
ccggagctagcgtgtgcccacaattcgcatgcaatgccccaggcacgtcgtcgtctggaa
cgaacgggcgctggtgttgccagttgccgtttcactggggaagcctttcactttgtcagc
tttgtgcccatcaatgggcaactattcgagctggacggcctcaagccgtatcccatgaat
cacggctgctgggaggagcacgaggactggacggacaagttccggcgtgtcatggctgag
cggctgggcatagccaccggtgagcaggatatacgtttcaatttgatggctgtcgtccca
gatcgacgcattgccatcacgcacaagctgaagatgttgcgcaccaatcaggccatcgtg
tccggcacactgcagaaactgctcaaggccgatgagcagggcgagcgcgatgagcaacag
cgtccggatacacccaccacactgctggagcccagtgcgtttacggcgcgtgatttgcaa
tctttgctcaagaatctggacacggaaatagccatcaatgagcagcacttggccgatgag
aatgatcgccggcaaatgttcaaggtggatgcaagtcgtcgcacccacaactatgacaag
ttcatctgcactttcctctccatgctggcgcatcaaggcgtcctgggcgagctggtcagc
caacatctgctaccgtccaagaagattgccaatcgcttgaaccgacagaccaacgctgcc
actgcagctgccaatgcggccaatactaatgtggctggaaccaatgcagctggctctaaa
tcccagcagcagcagcagcagacacaacaacaaccacaacagacccaaacagctaagaat
ggcaagtcgccgggaaagacgccaggacgaaggcgcaagggacgcaacaagtgcaggaag
cgcaagtga

DBGET integrated database retrieval system