KEGG   Drosophila grimshawi: Dgri_GH23041Help
Entry
Dgri_GH23041      CDS       T01061                                 

Definition
GH23041 gene product from transcript GH23041-RA
Orthology
K14298  
mRNA export factor
Organism
dgr  Drosophila grimshawi
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dgri_GH23041
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 347 aa AA seqDB search
MFGPAQTTTNRMNDFEVASPPDDSVSALEFSPSTLPKNYLIAGSWDNSVRCWEVEQNGAT
VPKSMKSMGGPVLDVCWSDDGTKVFMASCDKQVKLWDLASDQVMQVAAHDGPVKSCHMVK
GPNYTCLMTGSWDKTLKFWDTRTPTPMMAINLPERCYCADVDYPMAVVGTAGRGLIIYSL
ENSPTEYKRQESPLKYQHRAIAIFKDKKKTPTGYALGSIEGRVAIQYVNPVNPKDNFTFK
CHRSTGSSGFQDIYAVNDIAFHPIHGTLVTVGSDGTFSFWDKDARTKLKSSEAMDQSITK
CGFNANGQIFAYAVGYDWSKGHEYFNPAKKPQIFLRSCYDELKPRVN
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtttgggcccgcacaaaccacaacgaatcgtatgaacgacttcgaggtggcctcgccg
cccgacgactccgtctccgcgctcgaattcagtccgagcacactacccaagaattattta
attgccggcagctgggataacagcgtccgctgctgggaagttgaacaaaatggagccacg
gtgcccaaatcgatgaagtcgatgggtggcccagtgctggacgtatgctggtcggacgat
ggcaccaaagtctttatggcctcctgtgacaaacaggtcaaactgtgggatctcgcctcc
gatcaagtaatgcaagtggccgcccacgatgggccagtcaaaagttgtcacatggttaag
ggaccaaattacacgtgcctcatgaccggctcctgggacaaaacgctcaagttctgggac
acacgcactcccacacccatgatggccattaatctgcccgagcgttgctattgcgccgat
gtggactatcccatggccgtggtgggcacagcgggtcgtggcctaatcatctactcgctg
gagaacagtcccaccgagtacaagcgacaggagagcccgttgaaatatcagcatcgcgcc
attgccatcttcaaggataagaagaagacgcccacgggttatgcgctgggcagcatcgag
ggacgggtggccatacagtatgtgaatccagtgaatcccaaggataacttcacattcaag
tgccatcgttcgacgggcagttcgggtttccaggacatttatgcggtcaacgatattgca
ttccatcccattcatggcacgctggtcaccgttggctcggacggcaccttcagtttctgg
gacaaggatgcacgcaccaagctcaaatctagcgaagccatggatcaatcaattacaaaa
tgcggcttcaatgccaatggtcagatattcgcgtatgccgtcggctacgattggtccaag
ggccacgaatacttcaatcccgccaaaaagccacagatcttcctgcgctcctgctacgat
gaactgaaaccgcgcgtcaattga

DBGET integrated database retrieval system