KEGG   Drosophila grimshawi: Dgri_GH23348Help
Entry
Dgri_GH23348      CDS       T01061                                 

Definition
GH23348 gene product from transcript GH23348-RA
Orthology
K11252  
histone H2B
Organism
dgr  Drosophila grimshawi
Brite
Exosome [BR:dgr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dgri_GH23348
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 123 aa AA seqDB search
MPPKTSGKAAKKAGKAQKNITKNDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIM
NSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT
SSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgaaaactagtggaaaggcagccaaaaaggctggcaaggctcaaaagaacatc
accaagaatgacaagaagaagaagcgcaagaggaaggaaagctatgccatctacatttac
aaagtgttgaagcaggtccatcctgacactggcatttcgtcaaaggcaatgagcatcatg
aacagcttcgtgaatgatatttttgagcgtattgctgccgaggcatctcgtttggcccac
tacaacaaacgttcaaccatcacaagtcgggaaatccaaaccgctgtccgtctattactg
cccggagagttggctaagcacgccgtcagtgagggaaccaaagcagtcaccaagtacact
agctccaagtaa

DBGET integrated database retrieval system