KEGG   Drosophila grimshawi: Dgri_GH23497Help
Entry
Dgri_GH23497      CDS       T01061                                 

Definition
(RefSeq) GH23497 gene product from transcript GH23497-RA
  KO
K00731  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
dgr  Drosophila grimshawi
Pathway
dgr00512  Mucin type O-glycan biosynthesis
dgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    Dgri_GH23497
Enzymes [BR:dgr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  N-acetylgalactosaminide beta-1,3-galactosyltransferase
     Dgri_GH23497
Glycosyltransferases [BR:dgr01003]
 Glycan extension
  Type 3 chain
   Dgri_GH23497
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fringe Galactosyl_T
Motif
Other DBs
NCBI-GeneID: 6571834
NCBI-ProteinID: XP_001998003
FlyBase: FBgn0130954
UniProt: B4K3Z9
AA seq 274 aa AA seqDB search
MIVGFIVGFFLAVLFIHSSMPERDDYVLYYRYGQDVGTHDHVNENTSIAEKLYSCILCWI
MTNPANHQTKARHVKRTWGKRCNKLIFMSSAKDEELDAVALPIGEGLDNLWGKTKEAFEY
IYEHHMNDADWFLKADDDTYMIVENLRYMLYPYNPNTPVYFGCKFKPHVKQGYMSGGAGY
VLSREAVRRFVVEAIPNPKLCKKENTGEEDTQIGECLENVKVLAGDSRDANGRGRFFPFV
PEHHLIPSFMDKEFWYWEYIYYKTDEVGSFKFKL
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgattgtaggcttcatcgttggcttcttcctagcagtgctcttcattcactcgtccatg
ccggaacgtgacgactacgttctgtactatcgatatggccaggatgtaggcacacacgat
catgtcaacgaaaacaccagtattgcggagaagctgtacagctgtattctctgctggata
atgacgaatcccgccaaccatcagacgaaggcgcgccacgtgaagcgcacctggggcaag
cgttgcaataagttgatcttcatgagctcagccaaggatgaagagctggatgccgtggcg
ctgcccatcggcgagggactcgataatctgtgggggaaaacaaaggaagcatttgagtac
atctacgagcatcacatgaacgatgcagactggttcctcaaagcagacgatgacacctat
atgattgtagagaatttgcgctatatgctatatccctacaatcccaacacgccagtctat
tttggctgcaaattcaagccacatgtcaagcaaggctacatgtccggtggagctggttat
gttctcagtcgcgaggctgtgcgtcgcttcgtggtcgaagctattcccaatccgaaactg
tgcaagaaggaaaacactggcgaagaggatacgcaaattggtgagtgtttggagaacgtc
aaagttcttgcgggcgattcccgagatgccaatgggcgtggtcgattctttccttttgtg
ccggagcatcacttgataccttcgtttatggacaaggaattctggtactgggagtacatc
tattacaaaaccgatgaggtgggttctttcaaattcaaattgtag

DBGET integrated database retrieval system