KEGG   Drosophila grimshawi: Dgri_GH23526Help
Entry
Dgri_GH23526      CDS       T01061                                 

Definition
(RefSeq) GH23526 gene product from transcript GH23526-RA
  KO
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
dgr  Drosophila grimshawi
Brite
Enzymes [BR:dgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Dgri_GH23526
Protein kinases [BR:dgr01001]
 Serine/threonine protein kinases: AGC group
  AUR family [OT]
   Dgri_GH23526
Protein phosphatases and associated proteins [BR:dgr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dgri_GH23526
Chromosome [BR:dgr03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    Dgri_GH23526
   Spindle formation proteins
    Dgri_GH23526
  Sister chromatid separation proteins
   Aurora kinases
    Dgri_GH23526
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 398 aa AA seqDB search
MSHKPNNVLRNKENVLLKPGTSTSGVAPIAMQKKQLICAKKPTIENVAPVASTSKTAAQL
TTTKAPQIAEPQYQTQQQLPAASAAAVATKKGDTDLAKTEKQPASSATATGSSKSTDKDK
TETATATATAKPKKTWALSNFDIGRQLGRGKFGNVYLAREKESQFVVALKVLFKRQIGES
NVEHQVRREIEIQSHLRNPHILRLYAYFHDDARIYLILEYAPQGTLFSALQAQPLKRFDD
RQSATYIKALCSALMYLHERDIIHRDIKPENLLLGHKGVLKIADFGWSVHEPNSMRMTLC
GTVDYLPPEMVLNKPHTKNVDLWSLGVLCYELLVGHAPFYSKNFEETYKKILNVDYKLPE
HVSKAAAHLISKLLVLNPQHRLPLDQIMLHPWITAHTQ
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcacaagcctaataatgtgctgcgaaataaggaaaatgtattactaaagccagga
accagcacttctggagtcgctccaatagcaatgcagaaaaagcaactaatttgtgcgaaa
aagccaacaattgagaatgtggcgcctgtggctagcaccagcaaaactgccgcccaatta
acaacaacaaaggcgccacaaatagctgaaccgcaatatcagacacagcagcagctgcca
gcagcttcagctgcagctgtagccaccaaaaaaggggatacggatttggccaagactgag
aagcaaccggcgtcgtcagccactgcaacgggcagcagcaaaagcactgataaggacaag
actgagactgcaacggcaacggcaacagccaaacccaaaaagacctgggccttaagcaac
tttgacattggtcggcagttgggtcgcggcaaatttggcaatgtgtatttggcacgcgaa
aaggaatctcaatttgttgtcgccttgaaggtgctcttcaagcgacagattggcgaatcg
aatgtggagcatcaggtgcgacgcgaaatcgaaatccaatcgcatctgcgcaatccgcac
atcctgcgcctctacgcctattttcatgacgacgcgcgcatctatttgatactggagtat
gcgcctcaaggcacgctcttcagtgcattgcaggcgcagccgctgaagcgattcgatgat
cgtcagtcggcaacgtatatcaaggcgctgtgctcggcgctaatgtatttgcatgagcgt
gatatcattcatcgggatatcaagccggagaatttgttgttgggccacaagggtgtgctg
aagattgccgattttgggtggtcggtgcatgaaccgaattcgatgcggatgacgctgtgc
ggcacagttgattatctgccgcccgaaatggtgctaaacaagccacacaccaagaacgtg
gatctctggagcttgggtgtgctatgctacgagctgctggtgggtcatgcgccattctac
tcgaagaactttgaggaaacgtacaagaagatacttaatgtcgactataagctgccggag
cacgtttccaaagctgcagctcatttgatatcaaagctattagtgttaaatccgcagcat
cggttgccactggatcagatcatgttgcatccatggataacggcgcacacacagtga

DBGET integrated database retrieval system