KEGG   Drosophila grimshawi: Dgri_GH23546Help
Entry
Dgri_GH23546      CDS       T01061                                 

Definition
(RefSeq) GH23546 gene product from transcript GH23546-RA
  KO
K11252  histone H2B
Organism
dgr  Drosophila grimshawi
Brite
Chromosome [BR:dgr03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    Dgri_GH23546
Exosome [BR:dgr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dgri_GH23546
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like DUF1931
Motif
Other DBs
NCBI-GeneID: 6571803
NCBI-ProteinID: XP_001997974
FlyBase: FBgn0131003
UniProt: B4JZ50
AA seq 123 aa AA seqDB search
MPPKTSGKAAKKAGKAQKNITKNDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIM
NSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT
SSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgaaaactagtggaaaggcagccaaaaaggctggcaaggctcaaaagaacatt
accaagaatgacaagaagaagaagcgcaagaggaaggaaagctatgccatctacatttac
aaagtgttgaagcaggtccatcctgacactggcatttcgtcaaaggcaatgagcatcatg
aacagcttcgtgaatgatatttttgagcgtattgctgccgaggcatctcgtttggcccac
tacaacaaacgttcaaccatcacaagtcgggaaatccaaaccgctgtccgtcttttactg
cccggagagttggctaagcacgccgtcagtgagggaaccaaagcagtcaccaagtacact
agctccaagtaa

DBGET integrated database retrieval system