KEGG   Drosophila grimshawi: Dgri_GH24009Help
Entry
Dgri_GH24009      CDS       T01061                                 

Definition
GH24009 gene product from transcript GH24009-RA
Orthology
K15293  
protein unc-13
Organism
dgr  Drosophila grimshawi
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1707 aa AA seqDB search
MTQPPPAVSPLPASLTALHPCEASTHSHLNGLSQYRSGIWANQQQQQQQSLDIPGALFSR
EDDDNRSQHSARTFSSSRRQSTEDSIDTDDEYFCYELRQLEELEQQSREQREQEQEQEHE
QNEVLFSQIDGLNSWPSSDYLPDEAVKLRMSQVLKELLRCVPEVEAEMETASSASSKPNP
LEQGLNTPSRQQKSQKLLRVADMHSAWQDVNNEYQLASSENEYSPGKEREQEQERERAQE
REQRFSRKKKRVRNSKSYQNKSELKDLPTGSSSSAYTSEEEHEEQEKHEEQACKRKREQK
FEQFSMESDNEQKWSSSGATSGPDTPAVLSDELELDEEQLEEQEEQKLEQLEQEQKEQQQ
EHEVPKKQPCIQNATLPQAVLPTQATTALSVEVDQTMAQNSNAKRPFKLISQDSSVDVSQ
TGGVNGGVAGNLGSSKWKLLKTLKERKIEEKNNQDKMKEEELAKDKEKNGTAPGDVGLRS
NGHPGDNPFYSNIDSMPDIRPRRKSIPLVSELTMAATKRNAGLTSAVPRATLNDEELKMH
VYKKALQALIYPISSTTPHNFVLWTATSPTYCYECEGLLWGIARQGVRCTECGVKCHEKC
KDLLNADCLQRAAEKSSKHGAEDKANSIITAMKERMKQREREKPEIFELIRAVFSIEEKS
HTGHMKAVKQSVLDGTSKWSAKIAITVICAQGLIAKDKSGTSDPYVTVQVSKVKKRTRTM
PQELNPVWNEKFHFECHNSSDRIKVRVWDEDNDLKSKLRQKLTRESDDFLGQTIIEVRTL
SGEMDVWYNLEKRTDKSAVSGAIRLHISVEIKGEEKVAPYHVQYTCLHENLFHYLCEENC
GMVKLPTQKGDDAWKLYFDEIPEEIVDEFSMRYGIENIYQAMTHFHCLSAKYLCPGVPAV
MSTLLANINAYYAHTTASSAVSASDRFAASNFGKEKFVKLLDQLHNSLRIDLSMYRNNFP
ASSQEKLMDLKSTVDLLTSITFFRMKVQELSSPPRASTVVKDCVKACLRSTYQFLFENCY
ELYNREFQVDPNEAKRDTDDHGPKLDSVDFWHKLIALIVSVIDEDKNSYGTVLNQFPQEL
NIGQLSAATMWGLFAVDMKYALEEHEQHRLCKSSAYMNLHFRVKWLYSNYVKEVPPYKGA
VPEYPAWFEPFVMQWLNENDDVSLEYLHGAFNRDKKDGFQKSSEHALFSNSVVDVFTQLT
QCFDVVSKLECPDPEIWKRYMRRFAKTIVKVLIAYADIVKMEFPEHMRDERIACILMNNI
QQLRVQLEKMFESMGGDKLEEDAANILKELQQNLNSALDDLATQFAISLEPRITQSVREL
GDMLLSIKGGSGPLTAGNQAVQRNAVAVEADDVLRPLMDLLDGSLTLYAQSCEKTVLKRL
LKELWKIVMRILEKTIVLPPMNDKTMMFKHLTDNAKNLASNAKIEDMGRLFKSHMAGKQD
VKSALSGVMDISKEVEKNLSPKQCAVLDVALDTIKQYFHAGGNGLKKTFLEKSSELQSLR
YALSLYTQMTDTLIKTFISSQVHEVDPENAEESVGEISVQIDLFSHPGTGEHKVNVKVVA
ANDLKWQIPSGMFRPFVEINLIGPHLQDKKRKYATKSKSNNWSPKYNESFSFAIGNEEQL
DFFELHICVKDYCFARDDRLVGVAVIPLKDISEKGSVACWLPLQRRIEMDETGWTILRIL
SQRNNDEVAKEFVKLKSEIRQEPTMGT
NT seq 5124 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaccccctccagcagtgtcacccctaccagcctcactcacagcgctacaccct
tgcgaagccagcacgcactcgcatttaaatggtttatcgcaatatcgttctggtatttgg
gccaaccaacaacaacaacagcagcaatcgttggacataccaggagcactttttagtcgc
gaggacgatgacaatcgcagtcagcattcggcgaggaccttctcatcatcgcggcgccaa
agcaccgaggacagcatcgatacggatgatgaatatttctgctacgagctgagacaactt
gaggaactggagcagcagagtagagagcaacgggagcaggaacaggagcaggagcacgag
caaaatgaggtgctcttctcccaaatagatggactcaattcgtggcccagctccgattat
ttacccgacgaagctgtcaagctgagaatgtcgcaggtgctcaaggaactgctgcgctgt
gtgcccgaagtagaagccgaaatggaaacggccagctccgccagctccaagcctaatccg
ctcgagcagggattaaatacgccaagcaggcagcaaaaatcacagaaattgctgagagtc
gccgatatgcacagcgcttggcaagatgtcaacaatgagtatcaactggcgagcagcgaa
aatgagtattcaccggggaaggagagggagcaggagcaggaacgggaacgggcgcaggag
cgggagcaaagatttagcagaaagaaaaagagagtgcgaaacagcaaaagttatcagaat
aaaagtgaactaaaagatttgccaactggttcatccagctcagcatacacctctgaagag
gagcacgaggaacaggagaagcacgaggagcaggcatgtaaaagaaagagagagcaaaaa
tttgaacaattttcgatggaatcggataatgagcagaaatggtcatcaagtggagctact
tcgggtccagatacgccagcagtgcttagcgatgagctggaattagatgaggagcagctg
gaggagcaagaggagcagaagctagaacaactggagcaagagcaaaaggaacagcaacag
gagcacgaagtgcccaaaaagcaaccatgcatacaaaatgcaaccctgccacaggcagtg
ctgccaacgcaagcaacgacagcattgtcagttgaggtagatcaaacaatggcgcaaaat
tcaaatgcaaagcgcccatttaaattgattagtcaagattcaagtgtagatgtttcgcaa
acgggcggtgtaaatgggggcgtggctggcaatttgggcagcagcaagtggaaattgctg
aaaacactcaaagagcgcaaaattgaggaaaagaacaatcaggataaaatgaaggaagag
gaattggctaaagacaaggaaaagaatggcacggcacctggcgacgtgggtcttcgctcg
aatgggcatcctggcgacaatccgttctatagcaatatcgacagcatgcccgacattcga
cccaggcgtaaatccattccccttgtctccgagctgactatggcggcgacaaagcgcaat
gctggattgacgtcagcagtcccgcgagcgacgctcaacgacgaggaattgaaaatgcat
gtgtataagaaagcgctgcaagcgctgatatatccaatatcgtccacgacgccgcacaat
ttcgtgctttggacggcgacatcgccaacatattgctacgaatgcgaagggctgttgtgg
ggtatagcgcggcagggggtgcgctgcactgagtgcggcgtcaaatgtcacgagaagtgc
aaagatctgctaaacgccgactgcctgcaacgcgctgcggagaaaagttcgaaacatggc
gccgaggacaaagcgaattcgataatcacagcgatgaaggaacgcatgaaacagcgcgag
cgcgaaaagcccgaaattttcgaattgatcagagccgtattcagcattgaggagaaaagc
catacgggccacatgaaggccgttaagcaaagcgttctggatggcaccagtaaatggtcg
gcgaaaattgcgataacagtgatttgtgctcaaggcctgatagcgaaggataaaagcggt
acgagtgatccatatgtgacggtgcaggttagcaaggtgaaaaagagaacgcgcacaatg
ccccaggagctaaaccctgtgtggaacgagaagtttcactttgagtgccacaactcttcg
gatcgcataaaagtgcgcgtttgggatgaggataatgatttgaaatcgaaattgcgacag
aaattgacacgcgaatcggatgattttctgggtcaaaccattattgaagtccgtacgctg
tccggcgagatggatgtgtggtataatctggagaaacgtacggataaatcggccgtatcc
ggcgccattcgtttgcatatctccgtcgagatcaagggcgaggagaaggtggcaccctat
cacgtgcagtatacctgcctccacgagaacctcttccactatctctgcgaggagaactgc
ggcatggtcaagctgcccacgcaaaaaggtgacgatgcgtggaagctgtactttgacgag
attcccgaggaaattgtcgacgagttctcgatgcgatatggcatcgagaatatatatcag
gcgatgacccatttccactgtctgtcggcgaaatatctgtgtcccggcgtgccggctgtg
atgagcaccctgctggccaacataaatgcctattatgcgcatacgactgcctcctcggct
gtatcggccagcgatcgatttgcggctagcaattttggaaaggaaaagtttgtcaagttg
ttggatcagctgcataactcgttgcgcatcgatctatcgatgtatcggaataattttccc
gcatccagccaggagaaactcatggatctcaagtcaactgttgacctattgacctccata
acattcttccgcatgaaggttcaagaattatcgagtccaccgagagcgagcacggttgtc
aaggattgcgtcaaagcctgtcttagatccacttatcaattcctattcgagaactgctac
gagctctacaacagggagtttcaggttgatccaaacgaggccaaacgggataccgacgac
cacggaccaaagctggacagcgtcgacttctggcacaagctgatcgctctcatcgtatcc
gtgatcgatgaggacaagaacagttacggcactgtcctcaatcaattcccacaagaactg
aatatcggacagttatcggctgcgacgatgtggggcttgttcgccgtggacatgaagtac
gcattggaggaacatgagcagcatcgcttgtgcaagtcatcggcctacatgaatctgcac
tttcgtgtcaaatggctgtacagcaattacgtgaaagaggtgccaccctacaagggggcg
gtgcccgaatatcccgcctggttcgaacccttcgtcatgcagtggctcaacgagaacgac
gatgtctccctcgaatatctgcacggtgccttcaatcgtgacaaaaaggatggatttcaa
aagagcagtgaacacgctttgttctccaattcggttgtcgatgttttcacacaattgacg
cagtgcttcgatgttgttagcaaactcgagtgtccagatccagaaatttggaaacgttac
atgaggcgttttgctaaaactatcgttaaagtactcattgcctatgctgatattgtgaaa
atggagttcccagagcatatgagggacgaacgaattgcctgcattctgatgaacaacata
cagcagttgcgggttcaattggagaagatgttcgagtcgatgggcggcgataagctggag
gaggatgctgccaacattctcaaggagctgcagcagaacctcaactccgccttggatgat
cttgccacgcagtttgctataagtttggaaccacgcattacacaatcggttcgggaatta
ggcgacatgctactctcgatcaagggtggaagtggacctctgacagctggaaatcaggct
gtgcaaaggaatgcggttgccgttgaggcagacgatgtgctgaggcctttgatggatcta
ctcgacgggtccttgaccctgtacgcccagtcctgcgagaagacggtgctgaaacgactg
ctcaaggagctctggaagattgttatgcgaattctggagaagaccatagtgctgccccca
atgaatgacaagacgatgatgttcaagcacctaactgataatgcaaagaatctggcatcg
aatgcaaaaatcgaagatatgggccgtttgttcaaatcgcatatggccggcaagcaggat
gtgaaaagtgcccttagcggtgtcatggacatatcaaaggaggtggagaagaatttatcg
cccaaacaatgtgccgtactcgatgttgccttagacacaatcaaacaatacttccatgcc
ggtggcaatggactaaagaagaccttcctcgagaagtcatccgagctgcaaagtctccgc
tacgcgctcagcttatacacccaaatgacagacacactcatcaagacgttcatatccagc
caagtgcacgaagttgatcctgagaatgctgaggaaagtgtgggcgagatttcagtgcaa
atcgatctattctcgcatccgggcacgggagagcacaaagttaatgttaaagttgtggct
gccaacgatctgaagtggcaaataccttctggcatgtttaggccatttgtggagataaat
ctgattggaccacatctacaggacaaaaagcgcaagtatgcaacaaaatcgaagtcaaac
aactggtcgcccaaatacaatgaatccttcagttttgccattggcaatgaggagcaattg
gatttcttcgagctgcatatttgcgtcaaggactattgtttcgcccgtgacgatcgactc
gtgggcgtggcagtgatacccctcaaggatatatccgaaaagggatcggtggcatgctgg
ttgcctctgcagcgccgcatcgaaatggatgagacaggttggaccattttaaggatatta
tcgcaaaggaataacgacgaggttgccaaggaatttgttaagcttaaatcggagatacgt
caggaaccgaccatgggcacttaa

DBGET integrated database retrieval system