KEGG   Drosophila grimshawi: Dgri_GH24103Help
Entry
Dgri_GH24103      CDS       T01061                                 

Definition
GH24103 gene product from transcript GH24103-RA
Orthology
K06091  
MAGUK p55 subfamily member 5
Organism
dgr  Drosophila grimshawi
Pathway
Hippo signaling pathway - fly
Class
Environmental Information Processing; Signal transduction; Hippo signaling pathway -fly [PATH:dgr04391]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 997 aa AA seqDB search
MQANSNRSTISAQSSGTPSASTISSSQGKQQVVELSGYVIILVENAEGKIKLYGSPSDRD
NLEVGDEILEVNGLSLDNISRGEAIRHIHDCIKSCTICLRVRKKNDSRLAWDIGNSVQDA
FVIAVEEHARERLQRLAALNRVTPVDITQLSRKLNGNSKPLPPPRDHLRIEKDGRLISCA
PAPQLPDRRVPANGSQQHQQQQMQLQQQLQQQQQIAQIVEPTLEQLDSIKKYQEQLRRRR
EEEERIAQQNEFLRNSLRGSRKLKALQDSATATPSPGKAQQQQPTTAAAAAPTTIAGVEN
EAYLPDEELLTPAEHIDGYGELIAALTRLQGQLAKSGLSTLAGRVSAAHNVLASASVAHV
LAVRSAVLQRRRPRVAGPLHVSALGLQKEIVEMLTQSNTATAIELGNLLTSHEMEGLLLA
HDRIANHTDASPSPTLTPTLTPTPTPMMTATATATATATLSGHSSPVPQSKASASGRSMA
VLPPVVPSVPQSVAQRGAMPLPVAAVAVAVRGESPPGMSGCFGTLNDQNDNIRIIQIEKS
TEPLGATVRNEGEAVVIGRIVRGGAAEKSGLLHEGDEILEVNGQELRGKTVNEVCALLGA
MQGTLTFLIVPAGSPQPGGGVGMGMGNVMGMHPHHAGVGGMAHRDTAVLHVRAHFDYDPE
DDLYIPCRELGISFQKGDVLHVISREDPNWWQAYREGEEDQTLAGLIPSQSFQHQRETMK
LAIAEEAGLARSRGKEGAASKGATLLCARKGRKKKKKASSEAGYPLYATTAPDETDPEEI
LTYEEVALYYPRATHKRPIVLIGPPNIGRHELRQRLMADSERFSAAVPHTSRARREGEVP
GVDYHFITRQAFEADILARRFVEHGEYEKAYYGTSLEAIRTVVASGKICVLNLHPQSLKL
LRASDLKPYVVLVAPPSLDKLRQKKLRNGEPFKEEELKDIIATARDMEARWGHLFDMIII
NNDTERAYHQLLAEINSLEREPQWVPAQWVHNNRDES
NT seq 2994 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcgaacagcaaccgatcaacgataagcgcacaatcctcgggcacaccgtcggcc
tcaacgatatcctcgtcacagggcaagcaacaagttgtcgaactatctggatatgttatc
attctcgttgagaatgcggagggtaaaattaaattatacggctcaccgtccgatcgcgat
aatctggaagtgggcgatgagatactcgaggtcaatggccttagcctggacaatatatca
cggggcgaggccattcgtcacatacacgattgcatcaaatcatgcacaatttgtttacgt
gtacgcaaaaagaatgattcccgattggcgtgggatattggcaactcggtgcaggacgcg
tttgtcattgccgtcgaggagcacgcaagggaacgtctgcaacgattggcggccttgaat
cgtgttacgcccgtggacataacacagctgtccagaaagcttaatgggaactcgaagccg
ttaccgccgccacgtgatcatctgcgcattgagaaggatggacgtcttattagctgcgcc
cccgcacctcagttgcccgatcgacgagtgcccgccaatggcagtcagcaacaccagcaa
caacaaatgcagctgcaacagcaactacaacaacagcaacaaattgcgcaaattgtggag
ccaacactcgagcaattggacagcatcaagaaatatcaggagcaactgcgacgccgtcga
gaggaagaggagcgcatcgcccagcagaatgaattcctgcgaaatagtttgcgtggctcg
cgcaaactcaaggcgcttcaggactcggcaacggccacgccctcgccgggtaaggcacag
cagcagcaaccgacaacagcagcagcagcagcgccaacaacaattgctggcgttgagaac
gaggcctatctgccggacgaggaactgctgacgccagcggaacacatcgacggctatggc
gaactgattgcggcgctgacacggctccagggccaactggctaagagtgggctgagcacg
ctggccgggcgggtatctgcggcgcataatgtgctggccagcgccagtgtggcccacgta
ctggccgtccggagcgctgtgctgcaacgtcgacgtcctcgcgtggccgggccactgcac
gtgagcgcattggggctgcagaaggagattgtggagatgctgacgcagtcgaacacggcg
acggccattgagctgggcaatctgctgaccagccacgagatggagggtctgctgctggcg
cacgatcgcattgccaatcatacggatgcatcgccatcgccgacgttgacgccgacgctg
acgccgacgccgacgccaatgatgacggcgacagcgacagcgacggcgacggcaacgctt
agcggtcatagcagtcccgtgccgcaatccaaagcatcggcgagtggtcgaagtatggcg
gtcttgccaccagttgtcccatcagtgccacaatctgtggcacaacgtggcgccatgccc
ctgcccgttgcagctgtggcagtggcggtgcgcggcgaatcgccgccaggaatgagcggc
tgcttcggcacattgaacgatcagaatgacaacattcgcatcatccagatcgagaagtcc
acggagccacttggcgcaacggtgcgcaacgagggtgaggctgtcgtcattggccggatc
gttcggggtggtgctgcggagaagtcgggactgctccacgagggtgacgagatactggag
gtgaatggccaggagctgcgtggcaagacggtaaacgaggtgtgcgccctgctcggcgcc
atgcagggcactctcacattcctgattgtgcccgctggtagtccgcagcccggtggcggc
gtgggcatgggcatgggcaacgtgatgggcatgcatccacatcatgcgggtgtcgggggg
atggcgcatcgggatacggctgtgctgcatgtgcgtgcacatttcgattatgatccggag
gatgatctgtatataccgtgccgggagctgggcatcagtttccagaagggcgatgtgctg
catgtgatctcgcgcgaggatcccaactggtggcaggcgtatcgcgagggcgaggaggac
cagaccctggctggcctcattcctagtcagtcatttcagcatcagcgcgaaacaatgaag
ctggccattgccgaggaggcgggtctggcacggtcgcgtggcaaggagggtgccgccagc
aagggtgcaacgctcctctgcgcacgcaagggccgcaaaaagaagaagaaggccagctcc
gaggcggggtatccgctgtatgcgacaaccgcaccggacgaaacggatcccgaggagata
ctcacctacgaggaggtggcgctctactatccccgtgccacccacaagcgacccatcgtc
ctcatcggtccacccaacattggcaggcatgagctgcgacagcgcttgatggccgattcg
gagcgcttctcggcggcggtgccacacacttcccgggcccggcgcgagggcgaagtgccc
ggcgtggattatcattttataacgcgtcaggcgttcgaggcggatattctggcgcgtcgc
tttgtcgagcatggcgagtatgagaaggcctactacggcacatccctggaggccatacgc
acagtcgttgccagcggcaagatttgtgtgctgaatttgcatccgcagagtttgaagttg
ttgcgcgcctcggacctcaagccctatgtggtgctggtggcgccaccaagcctggataag
ttgcggcagaaaaagttgcgcaatggcgaaccctttaaggaggaggagctaaaggacatc
atcgccactgcacgcgacatggaggcgcgctggggtcatctctttgacatgatcatcatc
aacaatgatacggagcgcgcctatcaccagctgctggccgagatcaattcgctggagcgc
gagccgcaatgggtgcccgcccagtgggtgcacaacaatcgtgacgagtcatag

DBGET integrated database retrieval system