KEGG   Drosophila grimshawi: Dgri_GH24315Help
Entry
Dgri_GH24315      CDS       T01061                                 

Definition
GH24315 gene product from transcript GH24315-RA
Orthology
K11851  
ubiquitin carboxyl-terminal hydrolase 30 [EC:3.4.19.12]
Organism
dgr  Drosophila grimshawi
Brite
Enzymes [BR:dgr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dgri_GH24315
Peptidases [BR:dgr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dgri_GH24315
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 574 aa AA seqDB search
MESEKILMAAGVTVAAVVGAFVFWGPSGSRLRQRRGQIAGLHNFGRTCFLNTLLQALAAC
PQFIAWLQLYNGATPDRKSLISSMLSTLEVINGTHATLRGDPHSPGAVLRALNTLGWVIP
QEEHDAHELFHVLLSSLEEEATRPQQMGCLSDALLPTGLTTASEAASNDFNDTGAMTPLA
YRNVPAVGQRIGDQPNRPSSAMLSDFLNMEYDESTNLQRLVRSEAHTPDSPASVCERESA
DILTPTGATASFSGHSPFGYQSAVAAMDFINPQLPLNGSPILGGERLSRPRQPQSQQSQL
QHIDGLNRRVSSSCRSLERLNRGPGRVSIWSSMMPSQVAHPFQGAMGAQIVCNGCGSKSA
VRYDKFDSVTLNLPEQRRSGLSLGHLLSEYITSEDLSDVKCDSCNETTMHTKSVTFAKLP
ACLCIHIARTIWLNTGQLCKRQDYVHFPESLSMAPYSFVQPHLNSQAGTPWGSTMSLYSS
SLPMNNGGGAGGECFGTMFPKNLYRLLAVVVHSGEANSGHFVTYRRGSLRNAHRWFYTSD
TIVREVSIDEVLSVPAYLLFYDRGQQRGQQMQMR
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtgaaaagatattgatggctgccggtgtcactgtcgccgctgtggttggtgct
ttcgtcttttggggtccatcaggctcccgtttgcgtcagcgtcgcggtcaaatcgctgga
ctgcacaattttgggcgcacctgctttctgaatacactgctgcaggcgctggctgcctgc
ccgcaatttattgcctggctgcaattgtataatggcgccacgcccgatcgcaaaagcctg
attagctcgatgctgagcaccttagaggtgataaatgggacgcatgcaacacttcgcggt
gatccccattcaccgggtgcagtgctgcgtgcactgaacacactcggctgggtcataccg
caggaggagcacgatgcacatgagctgttccatgtgctcttgtcgtcactggaggaggag
gcaacgcggccacagcaaatgggctgcctgtcggatgcgctattgccaaccggcctaaca
acagcatcagaagcagctagcaatgattttaatgatacgggcgcaatgacgccgctggct
tatcgcaatgtgcccgctgtaggtcaacggattggggaccagcctaaccggccatctagt
gccatgctctctgattttctcaatatggaatacgatgagtctaccaacctgcagcgtctg
gtgcgctctgaagcgcatactcccgactctccagcctctgtttgcgaacgtgagtcggcg
gatattttaactccaacgggtgcgactgcatcattttcgggtcattcaccgtttggctat
caatccgcagttgccgcaatggattttattaatccacagctgccgctgaatggctcaccc
attctgggaggcgagcgtctgtcgcgccctcgccaaccgcagtcgcagcagtcgcagttg
cagcacattgacggcctcaatcgacgcgtttcgagctcgtgtcgctcgttggagcgcctt
aaccgtggacctggacgcgtgtccatttggtcgagtatgatgcccagtcaggtggcgcat
ccgtttcagggcgccatgggcgcccaaatcgtttgcaacggttgcggctccaagtcggcg
gtgcgatatgataaattcgatagtgtcaccttgaatctgcccgagcagcgtcgttccgga
ctaagtttggggcatctgttaagcgagtacatcacctccgaggatctgagcgatgtcaaa
tgcgattcgtgcaacgagacaacaatgcacaccaaatccgttacgttcgccaagctgccg
gcgtgcctctgcattcatattgcccgcaccatctggctaaacactgggcagctgtgcaag
cgacaggattacgtgcacttccccgagagtctatccatggcgccctacagcttcgttcag
ccgcatctcaacagtcaggcgggcactccttggggctccacgatgtccctgtattcctcc
agtctgcccatgaataatggcggcggcgccggtggcgagtgctttggcacaatgtttccc
aaaaatctataccggctgctggcggttgtcgtgcattccggcgaggcgaacagcggacac
tttgtcacctatcgacgcggctcgctgcgcaatgcccatcgctggttttacacttcggat
acgattgtgcgtgaggtgtccattgatgaggtgttgagtgtgcccgcctatttattgttc
tacgatcgtggacagcagcgtggacaacagatgcagatgcgctaa

DBGET integrated database retrieval system