KEGG   Drosophila grimshawi: Dgri_GH24436Help
Entry
Dgri_GH24436      CDS       T01061                                 

Definition
GH24436 gene product from transcript GH24436-RA
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
dgr  Drosophila grimshawi
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:dgr03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 2037 aa AA seqDB search
MDSVIEDMWTPYKRLYQICQSAIRNPNEMNPDLVQCLKKHKQNFTNLLRNPPKSEKSRAQ
LATISMEGVMLAGQSRKVVLSQELINEAIILSDMYDLDEIIALELLCSAQRQQIRHPGLP
RGLVAVLLYYDGRKAITCTLRDMFQAMSGVTWSTELPKEMTVVFDNYVQNLVEDSNILGR
LLELLAEMDTEKEIALLTKNRAFGSKRHQNQVLALYESTRKALAMCLFHWSAQRGLPKNI
AIRLLKQLANNTQGNTSEVTLIMLMALLYGYDTSVLLLAECDNQHISRLPILSDPEYVKC
FYEAIYAQTTWQTPQMDVIIKYSFGLTLASLRQAPIDLQTNAGAIINCDEQLIDEALAGN
VFTFFLRELLETNVVYEVEFIYRRLHQLITDFIDFMHAKVSELRGRSDETARVMLSFQNA
GLESPPNLDDNFELLMLCVAKLYGDKRIPVTLCNEYWGPTIAKATTTTPHNAAANSKSNT
SRAVSLFKFIRLASELLPQILMTPYLKMIAGLTRTEFAARAAFNLLKDSQNVSSTYAVSW
DNFFTALNCYFTNMRSDQQSIGGSIYRSRPMPRNIAPSETEIMISVLGIVQAVADNDEIS
RIVICEHVNWQTPQVLLGLLACTTSVALKGQILLTLAALSKSKESARSIWFHLEESQVIP
TMTKNSSAYASFSLAEEIVQNECRMETYKLSRGVLQLLNTLMTTHMPHRLGAGQRKGGYD
PYLHFVIDKIFLKFYNRAYKDPVERWEVGAKCMQLLYFLLATYQPKAADFDNDRDDYPHP
GYHIMLQLQVKSDMLRLILRIIEEAQEQLDDYNEFRGKPALEECALYALLLLEVAVAKQN
AFFEAANCSILLMGLNRMLLDLNPRSRQPDYVHNIIKFVTYNSWLPRHTLAAIKILSGFT
AQPDVVVQILNMYSPNSTEKLEIRRQFIECLEIDMLQLSDEQRRQYEALDRFGNAYHKDA
TGDAGDLDSNTSSVSDTISVSEMEVEDRQPMRIELQIKEAIVQLFEVNINQPLPNFVTFL
LGIDVMRDFMYNEQIQLNVNCSCINALVLILERHLEQQRQSDKYCEHTAHIVERIYRLFH
GFCASPQISEAILRYFRLTCNDFLLRHLGALPFRNNHRNHMLHAISHLMNCVSIEIRVAA
SHGQTTRYTLLCDILLAVNADVLHNGHSVPQELSTSLLMSAAGNQFGLGVTPCRQMMQTT
APELHANRLLDCLTLETLSLTQPDLEFFDERLVSTLLTECTANAAMHQHSAGVINIHKLH
CILMDELHLVQSSIANGQRKAVIDEITTLIQYAINLNGIRMQRLATYAFMKAWGNLVQLL
FSAMPETVLPVAVRKQHIIDIIEKIMFKVPPTQPLVKLSIQVTETMLVLLENLRHCYYHL
EDQRALDEHGNIICLNDATPGVDATIANNQQQQQQQAKNSAANNATHVISSSVSSNSCKS
SNLRFILKQLIAWIMTCEVKSQQLSINLYTSLLYCLRIVKRVRSDEQIEYNETLRTRSDS
CTTFGNLQADVEQEMKHKEMAAEIISEFGEKLIDTICHDVTTGHAMCSMLALSCLDIISE
LRAVNTLCDIIASRGYLKQVLYGLAQSDVELKDVLKPIPDSLRPLYMYESLMAFLMQMAQ
TYLGATQILAEGALGVLSNMRIYDMQPDLKASQQLTLERNEPDDFMPAVDARFRSILLPA
LSFCDSIIDSLGARNTSASTQLLNFLFSHIDMIEGMLRAATPFMGLGHLQQLAAITNIFA
RITCNDQAIMQDHHHLDSGAPSPEMTNRLSRLRQLLIVVLGRFTVNEATIRCMMQQERHQ
QQDPTDLTEVDKWQHIKYILDISANLSIYCRAGVTSHVRDGITSKYLLTTMINDVTPLSG
KTDSKKLSAIMVVILNQLKGSIAYYLSQKAIADNLVQQRASLPNITFGPSGKKNYLELSQ
RHNDKRSELKMSVFIAEQSLYLLWIHVDFYFRNAVIYSQENRSLINETCLDPNNMSVLNA
SQDEIVQLKQMLISTFNELFCSQLITASEGYTTKCKNFSAVLLRRIKALVQFAPQTS
NT seq 6114 nt NT seq  +upstreamnt  +downstreamnt
atggatagcgtgatcgaggacatgtggacgccatacaagcgtctgtatcagatttgccag
tcggccataaggaatcccaatgagatgaaccccgatttggtgcaatgcctcaagaagcac
aaacagaattttaccaatttgctacgcaacccgcccaaaagtgagaagagtcgtgcccag
ctggcaacgatatcaatggagggtgttatgctcgccggtcagtcgcgaaaagtggtactt
tcgcaggagctaatcaatgaggccattatattgtcggatatgtatgatctggatgagata
attgcactggagctgctctgctcagcacaacgtcaacagattcgtcatccgggcttgccg
cgtggccttgtcgccgttctcctctattatgatggacgcaaggcaattacctgcacactg
cgcgatatgtttcaagcaatgagcggcgtcacctggagcaccgaactgcccaaggagatg
accgtggtgttcgacaactatgtgcagaatctggttgaggattcgaatatacttggccgt
ctcttggagttgctcgccgaaatggacaccgagaaggagatcgcgttgttgacaaaaaat
cgtgcctttggctcgaagcgtcatcagaatcaggtgctggcactctatgagagcacacgc
aaggcactcgccatgtgcctgttccattggtccgcccagcgtggactacccaaaaatatt
gccatacgtctgctaaagcaattggccaacaatacacaagggaacaccagcgaggtcaca
ctgattatgctgatggcactgctctatggctatgatacgtccgtgctgctccttgccgaa
tgcgataatcagcacatatcacgtctgcccattttgagtgatccagagtatgtcaagtgc
ttctatgaggccatctatgcccagacaacttggcagacgccacaaatggatgtcatcatc
aagtacagcttcggtctgacattggccagtttgaggcaggcgcccatcgatcttcagaca
aacgctggcgctatcatcaattgcgatgagcagctcatcgatgaggcgcttgccggcaat
gtgttcaccttcttcctgcgtgagctgctcgagacaaatgtcgtctacgaagttgaattc
atttaccgtcgcttgcatcagttaattacggatttcattgactttatgcacgccaaggta
tcggagctgcgtggccgatcggatgagacggcccgtgtaatgctgagttttcagaatgcc
ggactcgaatcgccgccaaatctggatgacaattttgagctactgatgctgtgcgtggcc
aagttatatggcgataagcggatacccgtcaccctgtgcaacgagtattggggacctaca
attgccaaagcgacaacaacgacgccacacaatgcggccgcaaacagcaaatcaaacaca
tcgcgtgccgtctccttgttcaagttcatccgtttggccagtgagttgttgccgcagatt
ttgatgacgccgtatttgaagatgattgccggactgacgcgcaccgaatttgcggccaga
gcagcctttaatctgctcaaggactcacagaatgtatcgtccacctatgcggtcagctgg
gacaatttctttacggccctcaattgttatttcacgaatatgcgaagcgatcagcaatcg
ataggtggatcgatctatcgcagccggccgatgccgcgcaatatagcgccaagtgagaca
gagataatgatttctgtgctgggcattgtgcaggccgttgccgataatgatgaaatctca
cggattgtcatctgtgagcacgtcaattggcagacgccccaagtgctgttgggcctgctc
gcgtgcaccacatcggtggcactcaagggtcaaatcctattgacattggctgcactcagc
aaatcgaaagaatcggcacgctcgatctggttccatctggaggagtcacaagtgataccc
acaatgacaaagaactcgtcggcatatgcatcgttcagtttggcggaggagatcgtacag
aacgaatgtcgaatggagacatacaagttgagtcgtggcgtcctccagctgctcaatacg
ctgatgaccacacacatgccacatcgattgggcgctggacaacgcaagggcggctatgat
ccgtatttgcattttgttatcgataagatatttttaaagttctacaatcgggcgtacaag
gatcccgtggagcgttgggaagtgggtgccaaatgtatgcaactattatactttctgctt
gccacatatcagccgaaggcggccgattttgataacgatcgcgatgactatccgcatcca
ggctatcatataatgctgcaattgcaggtcaaatcggatatgttgcgtctgatattgcgc
atcattgaggaggcacaggagcagctagacgattacaatgagttccggggcaaaccggcg
ctcgaggaatgcgccctgtacgcgctcctgctgctcgaggtcgccgtcgccaaacagaat
gccttctttgaggcggccaattgtagtattttattgatgggcttgaatcgtatgctgctc
gatttgaatccgcgtagccgtcagccggactatgtgcacaacatcatcaagtttgtcacg
tacaacagttggctgccccgtcacacattggccgccatcaaaatcttgagcggtttcacc
gcccagcccgatgtcgttgtccaaatcctcaatatgtattcaccgaacagcaccgagaaa
ctggagatacgtcgccagtttattgaatgcctggaaatcgatatgctccaactgagcgat
gagcaacggcgtcaatatgaggcactcgatcgctttggcaatgcctatcataaggatgcc
acgggtgatgccggtgatcttgattcgaatacgagttcagtatcggatacgatatcggtt
tccgaaatggaagtcgaagatcgtcagccgatgcgcattgaattgcagattaaagaggca
attgtgcaactgttcgaagtcaatatcaatcagccgttgcccaattttgtcacctttctg
cttggcatcgatgtgatgcgtgattttatgtacaacgagcagattcagctcaatgtcaac
tgttcctgcatcaatgcgctggtcttgatccttgagcgccatctggagcaacaacgtcag
agtgataaatattgcgagcatacggcccacattgtggagagaatttacagattgttccac
ggcttctgcgctagtcctcagatatcggaggcaatattgcgctatttccgtttgacatgc
aatgattttctgttgcgccatttgggtgcactacccttccgcaacaatcacaggaatcac
atgctgcacgcgatcagccacctgatgaactgtgtctccatcgagatacgtgtggcggcc
tcgcatggccaaacgacacggtatacgctgctgtgcgatattttgctcgccgtaaatgcg
gatgtgctgcacaatggacacagtgtaccccaggagttgagcaccagtctgctaatgtcg
gcggccggtaatcaatttggtttgggtgtgacgccctgtcgacaaatgatgcagacaacg
gcacccgaattgcatgcgaatcgtttgcttgactgcctaacattggagacgctatcgttg
actcagccggatctggagttctttgacgaacgcttggtgtccaccttgctgacggagtgt
acggcaaatgcggcaatgcatcaacatagtgctggcgttattaatatccataagctgcac
tgcatactgatggatgaactgcatctggtgcagagctccattgccaatggtcagcgcaag
gctgtcatcgatgagatcacaacactcattcagtatgccatcaatttgaatggtattcga
atgcaacggctcgccacatacgccttcatgaaggcctggggtaatcttgtccagctgctg
ttcagcgccatgcccgaaacggtgctgccggttgccgttcgcaaacagcatattatcgat
atcattgagaagataatgttcaaggtgccgccaacgcagccgctggtcaagctctccata
caggtgacggaaacgatgttggtgctgctcgagaatctgcgtcactgctactatcatctg
gaggatcagcgtgccctcgacgagcatggcaatatcatctgtttaaatgatgcgacgccc
ggtgtggatgccaccatcgccaacaatcaacagcaacagcagcaacaggccaagaacagt
gccgcaaacaatgcgacgcatgttatcagcagcagcgtcagcagcaacagctgcaagagc
agcaatctgcgcttcatcctcaagcaactcatcgcctggataatgacctgtgaggtcaag
tcacagcagctgagcatcaatctttacacctcgctgctctactgtctccggattgtgaaa
cgtgtgcgcagcgacgaacagatcgagtacaatgaaacgttaagaacgcgctcggatagc
tgtacaacatttgggaatctgcaggcggatgtggagcaggagatgaagcacaaagaaatg
gccgcggagataatcagtgagtttggtgagaaactaattgatacgatctgtcacgatgtg
acgacgggacatgcgatgtgcagcatgctggccctatcctgcctggacataatatcggag
ctgcgtgcggtaaataccctatgcgatattatcgcatcgcgtggctatctcaagcaggta
ctctacggcctggcccaatcggatgtggagctgaaggatgtgctcaaaccgataccggat
agccttcggcccctatatatgtacgaatccctaatggcattcctaatgcaaatggcgcaa
acgtatttgggcgccacacaaattctcgctgagggtgcactcggtgtcctctccaatatg
cggatctatgatatgcaaccggatttgaaggccagccagcaattgacattggagcgcaat
gaaccggatgattttatgccagcggtggatgcacgcttccgttcgatcctgctgccggct
ctgtcattttgtgatagcatcattgattcacttggcgcacgcaacacatccgcgtcgacg
caattgctcaatttcctcttctcgcacattgatatgattgaaggcatgttgcgggcggcg
acaccgttcatgggtttgggacatttgcagcagctggcggcgatcaccaatatatttgcc
cgcatcacatgcaatgatcaggcaattatgcaggatcatcaccatctggacagtggcgcc
ccatcgccggagatgacaaatcgattgagccggctacgtcaattgttgattgttgtcctt
ggccgctttaccgttaatgaggcgacaattcgttgcatgatgcagcaggagcgccaccag
caacaagatcccaccgacctaaccgaggtggataagtggcagcatatcaaatacattctg
gatatatccgccaatctgtcgatctattgtcgcgccggcgtcacaagccatgtgcgagac
ggcatcacctccaaatatctattgacgaccatgatcaacgatgtgactcccctttcgggc
aaaacggactcgaagaaactgtccgcaatcatggtggtcatattgaatcaactcaaaggc
tccattgcctactatttgtcacagaaggcaattgccgacaatcttgtccagcagcgcgcc
tctctgcccaacattacattcgggccaagcggcaagaaaaactatttagaattaagccag
cgtcacaatgataaacgcagcgaactgaaaatgtccgttttcattgcggaacagagtcta
tatctgctctggatccatgtggatttctattttcgcaatgcggtcatctattcccaggag
aatcgtagtctaatcaacgaaacctgtttggatccaaacaacatgtccgtactgaatgct
tcgcaggatgagatcgtccagttgaagcagatgctcatctccacattcaacgaactgttc
tgttcgcaattaatcactgccagcgaaggatatacgaccaaatgcaagaactttagtgcc
gtcctattgcggcgcatcaaggcgcttgttcaatttgcaccacagacctcctaa

DBGET integrated database retrieval system